DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and cpa3

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_031758725.1 Gene:cpa3 / 100494117 XenbaseID:XB-GENE-853724 Length:418 Species:Xenopus tropicalis


Alignment Length:421 Identity:132/421 - (31%)
Similarity:205/421 - (48%) Gaps:20/421 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLFLG--ATLVAAEQDYEGYRIYEVIPSTADQADLLHQLSLQGYDFISETRLLG--HPSRV--I 66
            |:..||  |:.|.|:|.:.|.:::.....|.....|:|:        |.|...|.  ||...  :
 Frog     9 LIWVLGSAASAVLAKQTFHGDKVFRAKLQTEGHVALIHK--------IKEAIKLDFWHPDTADRM 65

  Fly    67 VSPAQLKHFQQLVEAEKMTLTLVNSNLGASIAEEFAQRQMQRLLAPITGKGRLSTERYYTHEEII 131
            |...:........:|:.:.:.|..:::...:.....|..::..|.......|.|..:|.|.|:|:
 Frog    66 VPHTEADFHVHSDQADSVQILLQQNSVPYEVLFHDLQEGIEAQLNNTKKSKRHSYTKYNTWEKIV 130

  Fly   132 NYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDGGFHAREWISPAAVLYV 196
            .:...|.:::|:.|....:|.|.|.|.:..:.:.|.|...  |.||||.|.|||||||||...:.
 Frog   131 EWTSKLTKKYPNLVQRIDIGKSVEGRPMYVLQVGNPDSAT--KAIFMDCGIHAREWISPAFCQWF 193

  Fly   197 IDQLVEQFEENAHLLKDYDWVILPLVNADGYEHTQTGTLARMWRKTRQPYTYAGQTCYGADPNRN 261
            :.:|::.......|:|...:.|||:.|.|||  ..|.|..|||||.|.|...|  .|.|.|.|||
 Frog   194 VKELIKGKNNIRELVKSLTFYILPVFNIDGY--VWTWTEDRMWRKNRSPSEDA--KCVGTDLNRN 254

  Fly   262 FDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSLADRGIMYLTLHSYGNYLLYPWGWTS 326
            |:..|.:.|:|..||::.|.|..|.||.||..|...:.|..|....|::.||:...||:|:.:|.
 Frog   255 FNISWCDIGSSDEPCSEIYCGAAAESEIETKNVASFIRSHVDSIKAYISFHSFSQMLLFPFSYTY 319

  Fly   327 DLPENWEDLDAVARTGAEAIENATGTVYTYGSSTNVLYIAAGASDDYGYYAGFNVSITMELPGAG 391
            :|..:.::||.:|:.....::...||.||||.|.:.:|..||:|||:.|..|...|.|.||...|
 Frog   320 ELAPDHKELDEIAKGAVAELQGLYGTSYTYGPSASTIYPTAGSSDDWAYSLGIKYSFTFELRDEG 384

  Fly   392 SIGFNPPVTRIDEFVTETWIGIRAMAEKVIE 422
            ..||..|.::|.....||.:.:..:|:.|::
 Frog   385 KKGFLLPQSQIKATCQETTLAVAYIAKYVLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416 11/72 (15%)
M14_CP_A-B_like 124..420 CDD:199844 108/295 (37%)
cpa3XP_031758725.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.