DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and LOC100490370

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_031749426.1 Gene:LOC100490370 / 100490370 -ID:- Length:491 Species:Xenopus tropicalis


Alignment Length:443 Identity:125/443 - (28%)
Similarity:217/443 - (48%) Gaps:48/443 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FSLGLLVLFLGATLVAAEQDYEGYRIYEVIPSTADQADLLHQL----------SLQGYDFISETR 57
            ::.|.|.|.:..|    ..:|:|..|.|:.|.:..|...|..:          .||..|...:|.
 Frog    46 WTFGTLTLQVCCT----GTEYDGGNILEITPESEKQVQCLQNILQSWLLDLLKPLQPEDINVKTT 106

  Fly    58 LLGH---PSRVIVSPAQLKHFQQLVEAE----KMTLTLVNSNLGASIAEEFAQRQMQRLLAPITG 115
            :  |   ||..:          |||:.:    ..:|.::..|:.....::...::.::.:     
 Frog   107 V--HVRIPSTAL----------QLVKEDLLHCSQSLEILTGNVKYIEEDKIDTKETRKTI----- 154

  Fly   116 KGRLSTERYYTHEEIINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDG 180
             ...:...|:...||.::|:.:|::....|....:|.:||.|.::.:.|:. ..:.:||::::|.
 Frog   155 -NEYNYTTYHPMNEIYDWINGIAKKHSQFVTQHLLGLTYESRPMQYLKISQ-PSENHKKIVWIDC 217

  Fly   181 GFHAREWISPA-AVLYVIDQLVEQFEENAH---LLKDYDWVILPLVNADGYEHTQTGTLARMWRK 241
            |.||||||:|| ...:|.:|:|:.::.:..   :|::.|..:||::|.|||.:  :.|..|:|||
 Frog   218 GIHAREWIAPAFCQWFVKEQIVQNYQNDQRIRKILQNLDIYVLPVLNIDGYIY--SWTKERLWRK 280

  Fly   242 TRQPYTYAGQTCYGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSLADRGI 306
            .|.  .|...||||.|.||||:..|....:|:|..::::.|.:..|||||..|.:.:.|.....:
 Frog   281 NRS--QYGNGTCYGVDLNRNFNVSWCTHRSSTNCSSNSFCGSSPVSEPETRAVVEFVESRKADIV 343

  Fly   307 MYLTLHSYGNYLLYPWGWTSDLPENWEDLDAVARTGAEAIENATGTVYTYGSSTNVLYIAAGASD 371
            .:||:|||...:|..:|:::.|..|:.::..||...|.|:|...||.|..|..:.:||.|:|.|.
 Frog   344 CFLTMHSYSQLILTAYGYSTGLSRNYNEIFKVAEMAASAMEKIHGTKYRAGPFSKLLYEASGTSQ 408

  Fly   372 DYGYYAGFNVSITMELPGAGSIGFNPPVTRIDEFVTETWIGIRAMAEKVIEMY 424
            |:.:..|.:.|.|.||...||..|..|..:|.....||..|:..:.|.|.|.|
 Frog   409 DWVHDLGIDFSFTFELRDNGSHKFTLPEDQIQPTCEETMAGVMTIIEYVNEKY 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416 16/85 (19%)
M14_CP_A-B_like 124..420 CDD:199844 99/299 (33%)
LOC100490370XP_031749426.1 Propep_M14 73..>123 CDD:396700 12/61 (20%)
Peptidase_M14_like 159..457 CDD:416253 99/302 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.