DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8562 and agbl1

DIOPT Version :9

Sequence 1:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_002933362.2 Gene:agbl1 / 100485158 XenbaseID:XB-GENE-950762 Length:1164 Species:Xenopus tropicalis


Alignment Length:174 Identity:36/174 - (20%)
Similarity:58/174 - (33%) Gaps:68/174 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 MTLTLVNSNLGASIAEEFAQRQMQRLLAPI-TGKGRLS-----TERYYTHEEIINYIDDLAQRFP 142
            :|:|.:.|....|..:|...||...|.|.: .|:...|     |..:.|..:.|..|  |.:.| 
 Frog   778 VTITAMPSAKRRSHYQELRSRQYMVLTARVHPGESNASWVMKGTLEFLTSNDPIAEI--LREMF- 839

  Fly   143 SRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDGGFHA---------REWISPAA------ 192
                           :.|.:.:.|.||..|        |.|.         |:|:||.:      
 Frog   840 ---------------IFKIVPMLNPDGVIN--------GNHRCSLNGEDLNRQWMSPKSHLQPTI 881

  Fly   193 -----VLYVIDQLVEQFEENAHLLKDYDWVILPLVNADGYEHTQ 231
                 :||.::.:.:                .|||..|.:.|:|
 Frog   882 YHLKGLLYHLNSINK----------------TPLVFCDYHGHSQ 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416 4/14 (29%)
M14_CP_A-B_like 124..420 CDD:199844 24/128 (19%)
agbl1XP_002933362.2 Pepdidase_M14_N 602..734 CDD:375499
M14_Nna1 758..1025 CDD:349477 36/174 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.