DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and AGBL4

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:322 Identity:66/322 - (20%)
Similarity:109/322 - (33%) Gaps:121/322 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 YP-RYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVR---PRRVAYIQAATH- 205
            || .|.....::..|..|...:...|.||:|.:.|.:..|:|:....:|   .::|.:|....| 
Human   179 YPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHP 243

  Fly   206 ----------------------------GREWITTQTVLYLAYELLSNLRAFTRVLQDVEIF-LV 241
                                        |..|::...:     :.|.:......||::..:| :.
Human   244 GETPSSFVCQGIPPGHWAALSSSFQNSPGIHWMSPGII-----DFLVSQHPIACVLREYLVFKIA 303

  Fly   242 PLVNPDGYEYTHTTDRFWRKNRHRYAG-HSCS--GVDINRNFGNHW---------NYQGASQNLC 294
            |::||||.                |.| :.||  |.|:||    ||         ...|..| |.
Human   304 PMLNPDGV----------------YLGNYRCSLMGFDLNR----HWLDPSPWVHPTLHGVKQ-LI 347

  Fly   295 SEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFI-FYPYG--------YAKNTVPPT 350
            .::|      ::|:||     |||       .:|:|:....: .:.||        :.:..:.| 
Human   348 VQMY------NDPKTS-----LEF-------YIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFP- 393

  Fly   351 VGTLRSVALRAANQIGRYRGTRYT-----TGTSASILYEASGSLDDFAYGNLGIPLSYTLEL 407
                 .:..:.|.... |..|.:.     .||....|   .|.||..:|       .||||:
Human   394 -----KLLCQNAEDFS-YSSTSFNRDAVKAGTGRRFL---GGLLDHTSY-------CYTLEV 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 66/322 (20%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 63/311 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.