DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and AGBL5

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_068603.4 Gene:AGBL5 / 60509 HGNCID:26147 Length:886 Species:Homo sapiens


Alignment Length:395 Identity:74/395 - (18%)
Similarity:128/395 - (32%) Gaps:150/395 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RQARGFFSH-YP-RYHEVLSFMSGLAARYPQ------------FCRYESLGRSNEGRHIAALSIS 187
            |.|..||:. || .|.:....::.|..|:|:            :...|.|..|.:|..:..|:|:
Human   147 RGATTFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYHRELLCYSLDGLRVDLLTIT 211

  Fly   188 L------------------NSRVRP-----RRVAYIQAATHGREWITTQTVL---YLAYELL-SN 225
            .                  .|..||     :|:.::.:..|..|  |..:.:   :|.:.|. .:
Human   212 SCHGLREDREPRLEQLFPDTSTPRPFRFAGKRIFFLSSRVHPGE--TPSSFVFNGFLDFILRPDD 274

  Fly   226 LRAFTRVLQDVEIF-LVPLVNPDG-----YE-------------------------------YTH 253
            .||.|  |:.:.:| |:|::||||     |.                               |.|
Human   275 PRAQT--LRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHH 337

  Fly   254 TTDRFWRKNRHRYAGHSC---------------------SGVDINRNFGNHWNYQGASQNLCSEV 297
            ...|...::...:...||                     .|...:|:....|.....::...:.|
Human   338 VHSRLNSQSSSEHQPSSCLPPDAPVSDLEKANNLQNEAQCGHSADRHNAEAWKQTEPAEQKLNSV 402

  Fly   298 Y---------SGTAPNS-EPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYG--------YAK 344
            :         ..:||:: .|:.|.|..|::.:.:..|.       |.|:   ||        ..:
Human   403 WIMPQQSAGLEESAPDTIPPKESGVAYYVDLHGHASKR-------GCFM---YGNSFSDESTQVE 457

  Fly   345 NTVPPTVGTLRSV-------ALRAANQIGR-YRGTRYTTGTSASILYEASGSLDDFAYGNLGIPL 401
            |.:.|.:.:|.|.       .....|...| .|..:...|:....:|:|||.:.           
Human   458 NMLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIH----------- 511

  Fly   402 SYTLE 406
            |||||
Human   512 SYTLE 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 70/385 (18%)
AGBL5NP_068603.4 M14_AGBL5_like 176..568 CDD:199860 65/366 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..364 2/19 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 605..734
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 784..848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.