DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and agbl5

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_017210489.1 Gene:agbl5 / 445479 ZFINID:ZDB-GENE-040822-29 Length:886 Species:Danio rerio


Alignment Length:339 Identity:70/339 - (20%)
Similarity:117/339 - (34%) Gaps:112/339 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RRKTQFEASLSSLGVSYEMQPLMELMAALQANSSFADDNYDGEYEECQQDECEQAERPRRRTRRQ 138
            |.:..||.|.|...:|: :..|:::...    :::....|...|.|| ||...|.:         
Zfish   118 RDRPTFEMSDSQFILSF-VHRLLDVRGV----TTYFSFCYPFSYAEC-QDMMLQLD--------- 167

  Fly   139 ARGFFSHYPRYHEVLSFMSGLAARYPQFCRY---ESLGRSNEGRHIAALSIS------------- 187
                       |:.||..|...|..|....|   |.|..|.:|..:..:::|             
Zfish   168 -----------HKFLSSTSTHTACSPPESIYYHRELLCHSLDGHRVDLITVSSCHGLLEEREPRL 221

  Fly   188 ----------LNSRVRPRRVAYIQAATHGREWITTQTVLYLAY--ELLSNLRAFTRVLQDVEIF- 239
                      .:.|...:||.::.:..|..|  |..:.::..:  .:||......:.|:.:.:| 
Zfish   222 DKLFPDLSTARSHRFTGKRVFFVSSRVHPGE--TPSSFVFNGFLNFILSQEDPRAQTLRRMFVFK 284

  Fly   240 LVPLVNPDGYEYTH-TTDRFWRKNRHRYAGHSCSGVDINRNFGN-----HWNYQGA-SQNLCSEV 297
            |:|::||||....| .||              ..||::||.:.|     |.:..|| |..|...:
Zfish   285 LIPMLNPDGVVRGHYRTD--------------SRGVNLNRQYVNPSPDLHPSIYGAKSLMLYHHI 335

  Fly   298 YS--GTAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYGYAKNTVPP-TVGTLRSVAL 359
            ::  |.|..|..:||        |::                       ||.|| ...|.|...:
Zfish   336 HNRLGHASGSALKTS--------NQS-----------------------NTSPPVATPTERERCM 369

  Fly   360 RAANQIGRYRGTRY 373
            ...|:..|..|..:
Zfish   370 NLLNEAERGEGPTF 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 56/267 (21%)
agbl5XP_017210489.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.