DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and CG8564

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:364 Identity:117/364 - (32%)
Similarity:167/364 - (45%) Gaps:55/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ECEQAERPRRRT------RRQA--RGFFSH-YPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGR 179
            :|:.| :.|.||      ||..  |....| |..|.:|..::..||.||..|.....||.::|.|
  Fly    24 KCQTA-KDRSRTDATTALRRLVIPRPDILHTYLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKR 87

  Fly   180 HIAALSI----SLNSRVRP-----------------------------RRVAYIQAATHGREWIT 211
            .|.||.|    |.|..:.|                             |:..:|:|.||.||||:
  Fly    88 EIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWIS 152

  Fly   212 TQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYEYTHTTDRFWRKNRHRYAGHSCSGVDI 276
            ..|.|...|:|.........||:.:...:|||||||||||:.|.:..|||||..:......|.|.
  Fly   153 VSTALNCIYQLTERYTRNIEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDC 217

  Fly   277 NRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYG 341
            |||:...|| .|.|: :....|.|.:|.|||||.|:...|:...:.:...|.:||:|:.|.||:|
  Fly   218 NRNYDIFWN-SGPSK-INRNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWG 280

  Fly   342 YAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEA-SGSLDDFAYGNLGIPLSYTL 405
            |.::. |.....|.|:|....:.|..|.|..|.||:.:.:.... :||:.|:.||.|.:|::..:
  Fly   281 YCRDN-PIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVM 344

  Fly   406 ELPGDE--FHVPAHDIIHVCKETFAGFIEF------IRH 436
            |||..|  |..|...|..:..|::.|..|.      :||
  Fly   345 ELPSRELGFQPPVEMISQIGHESWYGIREMCKRSFDLRH 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 108/333 (32%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 106/325 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.