DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and CG32379

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:313 Identity:100/313 - (31%)
Similarity:156/313 - (49%) Gaps:17/313 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 NYDGEYEECQQD-----ECEQAERPRRRTRRQ------ARGFFSHYPRYHEVLSFMSGLAARYPQ 165
            ||..||:...:|     ..::||..|::...|      ...|::|    .|:..::..|..|:|:
  Fly     3 NYHLEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTH----SEINDYLDSLLERFPK 63

  Fly   166 FCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYIQAATHGREWITTQTVLYLAYELLSNLRAFT 230
            ..:.:..|.|.|.|.:..|:|:.....|.:.|..|....|.||||:....||:..:||.|.....
  Fly    64 RVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDNQ 128

  Fly   231 RVLQDVEIFLVPLVNPDGYEYTHTTDRFWRKNRHRYAGHSCSGVDINRNFGNHWNY-QGASQNLC 294
            .:|||.:..::|:||.||||||||..|:|||:|...:...|.|.|||||||..|.: :|:|.:.|
  Fly   129 ELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPC 193

  Fly   295 SEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYGYAKNTVPPTVGTLRSVAL 359
            ..:|.|..|..:.|:..:...:...:.|:...|.:||:|.:...|:||..: .|.|...:.|||.
  Fly   194 ENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSD-FPDTYQDMMSVAD 257

  Fly   360 RAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGNLGIPLSYTLELPGDEF 412
            ..|..|.......|:.|::..:||..||...|||:|.:...::.|:|||...|
  Fly   258 AGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 89/268 (33%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 91/272 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466942
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.