DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and Cpa6

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:294 Identity:95/294 - (32%)
Similarity:142/294 - (48%) Gaps:16/294 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 HEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYIQAATHGREWITTQT 214
            |.:.....||...:|       :|||.|||.:..:.:...|:|. :|..:|....|.||||....
  Rat     2 HHLNQTQPGLVRVFP-------IGRSFEGRSLLIIQLGRKSQVY-KRAVWIDCGIHAREWIGPAF 58

  Fly   215 VLYLAYELLSNLR---AFTRVLQDVEIFLVPLVNPDGYEYTHTTDRFWRKNRHRYAGHSCSGVDI 276
            ..:...|.:...:   |..::|..:..:::|::|.|||.::.|.||||||.|.|.:...|.|||.
  Rat    59 CQWFVKEAILTYKTDPAMRKMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRGVDA 123

  Fly   277 NRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYG 341
            |||:...|..:|||.:.|.:.|.|..|.||||..||..:|..:|.|::..|..|::.:.:.|||.
  Rat   124 NRNWKVKWCDEGASADPCDDTYCGPFPESEPEVKAVANFLRKHRKRIRAYLSFHAYAQMLLYPYS 188

  Fly   342 YAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGNLGIPLSYTLE 406
            |...|: |....:...|.:|...:....|.||..|.::..||.:||:..|:||.| |||.|:..|
  Rat   189 YKHATI-PNFSCVEFAAHKAVKALRSVHGIRYRHGPASQTLYVSSGNSMDWAYKN-GIPYSFAFE 251

  Fly   407 LPGD---EFHVPAHDIIHVCKETFAGFIEFIRHV 437
            |...   .|.:|...|...|.||.........|:
  Rat   252 LRDTGYFGFLLPEMLIKPTCTETMLAVKNITMHL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 94/292 (32%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 95/294 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351600
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.