DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001099570.1 Gene:Agtpbp1 / 290986 RGDID:1306307 Length:1219 Species:Rattus norvegicus


Alignment Length:457 Identity:100/457 - (21%)
Similarity:156/457 - (34%) Gaps:136/457 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YTKYTVQHGDENAFKYMVD-------LQTNDAELDFWLLTRNSSVLTVSPRRKTQFEASLSSLGV 88
            ||  |.:.||...|....:       :|...:|.|   |..||.:.:....:...||.|....||
  Rat   694 YT--TPEEGDILKFNSKFESGNLRKVIQIRKSEYD---LILNSDINSNHYHQWFYFEVSGMRPGV 753

  Fly    89 SYE----------------MQPLM-ELMAALQA-------------------NSSFADDNYDGE- 116
            :|.                ||||| .:..||.|                   .||.|.....|: 
  Rat   754 AYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKS 818

  Fly   117 YEEC--------QQDECEQAERPRRRTRRQARGFFSHYPRYHEVLSF-MSGL-AARYPQ--FCRY 169
            |...        :.|.|.               |..|||..:..|.. :..| :|..||  :.|.
  Rat   819 YYTITFTVVFPHKDDVCY---------------FAYHYPYTYSTLQMHLQKLESAHNPQQIYFRK 868

  Fly   170 ESLGRSNEGRHIAALSISLN---------SRVRPRRVAYIQAATHGRE----WITTQTVLYLAYE 221
            :.|..:..|.....::|:..         .:.|.|...::.|..|..|    |:...|:.|    
  Rat   869 DVLCETLSGNSCPLVTITAMPESSYYEHICQFRTRPYIFLSARVHPGETNASWVMKGTLEY---- 929

  Fly   222 LLSNLRAFTRVLQDVEIF-LVPLVNPDGYEYTHTTDRFWRKNRHRYAGHSCSGVDINRNFGNHWN 285
            |:|| ....:.|::..|| :||::||||.          ....||.   |.||.|:||      .
  Rat   930 LMSN-SPTAQSLREAYIFKIVPMLNPDGV----------INGNHRC---SLSGEDLNR------Q 974

  Fly   286 YQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDV--HSFGKFIFYPYGYA-KNTV 347
            :|..:..|...:|         ....:::||...:....:..|.  ||..|.:|. ||.: |.||
  Rat   975 WQSPNPELHPTIY---------HAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFM-YGCSIKETV 1029

  Fly   348 ------PPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEAS--GSLDDFAYGNLGIPLSYT 404
                  ..:...:..:..|...:|..:....:.. :|.|.:.|.|  .:.....:..:|:..|||
  Rat  1030 WHTHDNAASCDVVEDMGYRTLPKILSHIAPAFCM-SSCSFVVEKSKESTARVVVWREIGVQRSYT 1093

  Fly   405 LE 406
            :|
  Rat  1094 ME 1095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 65/290 (22%)
Agtpbp1NP_001099570.1 Pepdidase_M14_N 705..839 CDD:407865 29/151 (19%)
M14_Nna1 862..1132 CDD:349477 59/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.