DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and Agbl5

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_036020907.1 Gene:Agbl5 / 231093 MGIID:2441745 Length:1007 Species:Mus musculus


Alignment Length:409 Identity:80/409 - (19%)
Similarity:127/409 - (31%) Gaps:178/409 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RQARGFFSH-YP-RYHEVLSFMSGLAARYPQ------------FCRYESLGRSNEGRHIAALSIS 187
            |.|..||:. || .|.:....:|.|..|:.:            :...|.|..|.:|..:..|:|:
Mouse   268 RGATTFFAFCYPFSYSDCQDLLSQLDQRFSENYSTHSSPLDSIYYHRELLCYSLDGLRVDLLTIT 332

  Fly   188 ----LNSRVRPR-------------------RVAYIQAATHGREWITTQTVL---YLAYELL-SN 225
                |.....||                   |:.::.:..|..|  |..:.:   :|.:.|. .:
Mouse   333 SCHGLRDDREPRLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPGE--TPSSFVFNGFLDFILRPDD 395

  Fly   226 LRAFTRVLQDVEIF-LVPLVNPDGYEYTH-TTDRFWRKNRHRYAGHSCSGVDINRNFGN-----H 283
            .||.|  |:.:.:| |:|::||||....| .||              ..||::||.:..     |
Mouse   396 PRAQT--LRRLFVFKLIPMLNPDGVVRGHYRTD--------------SRGVNLNRQYLKPDAVLH 444

  Fly   284 WNYQGA--------------------------------------SQNLCSEVYSGTAPNSE---- 306
            ....||                                      :.||.:|.:.|.:|:.|    
Mouse   445 PAIYGAKAVLLYHHVHSRLNAKSPTNQQPTLHLPPEAPLSDLEKANNLHNEAHLGQSPDGENPAT 509

  Fly   307 -PET--------------------------------SAVVRYLEFNRNRVKLSLDVHSFGKFIFY 338
             |||                                |.|..|::.:.:..|.       |.|:  
Mouse   510 WPETEPAEEKTDPVWLMPQPIPELEEPAPDTIPPKESGVAYYVDLHGHASKR-------GCFM-- 565

  Fly   339 PYG--------YAKNTVPPTVGTLRSV-------ALRAANQIGR-YRGTRYTTGTSASILYEASG 387
             ||        ..:|.:.|.:.:|.|.       .....|...| .|..:...|:....:|:|||
Mouse   566 -YGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASG 629

  Fly   388 SLDDFAYGNLGIPLSYTLE 406
            .:.           |||||
Mouse   630 IIH-----------SYTLE 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 76/399 (19%)
Agbl5XP_036020907.1 Pepdidase_M14_N 102..>214 CDD:407865
M14_AGBL5_like 304..695 CDD:349455 70/373 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.