DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8563 and cpo

DIOPT Version :9

Sequence 1:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:304 Identity:103/304 - (33%)
Similarity:159/304 - (52%) Gaps:15/304 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 YPRYH---EVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYIQAATHGR 207
            |.:||   |:.::|:.:....|......:.|::.|.|:|..|.|..:| ..|::..::....|.|
Zfish    32 YTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSS-TTPKKAIWMDCGIHAR 95

  Fly   208 EWITTQTVLYLAYELLSNLRAFTRV---LQDVEIFLVPLVNPDGYEYT--HTTDRFWRKNRHR-Y 266
            |||......:...|:|.:.:..:||   .::::.::.|::|.|||.|:  :.:.|.|||:|.. :
Zfish    96 EWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRKSRSPCH 160

  Fly   267 AGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHS 331
            ...:|||.|:||||..:|...|.|:|.|||||:|....||||..||..:|..::|.:...|.:||
Zfish   161 ENSTCSGTDLNRNFYANWGMVGISRNCCSEVYNGATALSEPEAEAVTDFLGAHQNHLLCYLTIHS 225

  Fly   332 FGKFIFYPYGYAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGN 396
            :|:.|..|||: .|...|....|..|.|.||..|....|..|..|:|..:||..|||..||| ..
Zfish   226 YGQLILVPYGH-PNISAPNYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYPNSGSSRDFA-RL 288

  Fly   397 LGIPLSYTLELPGDEFH---VPAHDIIHVCKETFAGFIEFIRHV 437
            :|||.|:|.||..:..|   :|...|...|:|.:.|.:..|.:|
Zfish   289 IGIPYSFTFELRDEGQHGFILPEDQIQPTCQEAYEGAMSIINYV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 102/302 (34%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 101/299 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593411
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.