DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and ECM14

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_012000.1 Gene:ECM14 / 856533 SGDID:S000001174 Length:430 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:96/335 - (28%)
Similarity:152/335 - (45%) Gaps:46/335 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118
            |.|...:..:|..|.:.:...|.|..||.|.|.||::||.|   :....|.:|:           
Yeast   121 YRDLDTIYMWLDLLERSFPSLVAVEHLGRTFEGRELKALHI---SGNKPESNPE----------- 171

  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERY---TRNIEVLRKLRFI 180
                             :||:.|..|.||||||||||....:|||..||   .:..:.|..|.|:
Yeast   172 -----------------KKTIVITGGIHAREWISVSTVCWALYQLLNRYGSSKKETKYLDDLDFL 219

  Fly   181 IVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKINRNTYKGESPFSE 245
            ::|:.|||||.|:.:.:..|||||:.....:.:|.|.:.::...|....:......|.||:||..
Yeast   220 VIPVFNPDGYAYTWSHDRLWRKNRQRTHVPQCLGIDIDHSFGFQWEKAHTHACSEEYSGETPFEA 284

  Fly   246 PETRAMRCILDRMSSN--LLFFLSLHSYGQSIMYPWGY-CRDNPIYWRELSSLANSGKSAIKSYN 307
            .|..|....::....:  :..::.:|||.|.|:||:.| |...|.....|..|:.....||:|.:
Yeast   285 WEASAWYKYINETKGDYKIYGYIDMHSYSQEILYPYAYSCDALPRDLENLLELSYGLSKAIRSKS 349

  Fly   308 GREYRTGSISCLTKRTI------AGSVVDYVYGVLKVPMALVMEL-PSRELGFQPPVEMISQIGH 365
            ||.|...| :|..:.:.      |||.:|::|. .:...|..::| .:...||..|.|.|..:|.
Yeast   350 GRNYDVIS-ACKDRGSDIFPGLGAGSALDFMYH-HRAHWAFQLKLRDTGNHGFLLPPENIKPVGK 412

  Fly   366 ESWYGIREMC 375
            |::..::..|
Yeast   413 ETYAALKYFC 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 96/335 (29%)
ECM14NP_012000.1 M14_CP_A-B_like 121..425 CDD:349433 96/335 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.