DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and AT5G42320

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:319 Identity:72/319 - (22%)
Similarity:127/319 - (39%) Gaps:88/319 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ILGHTHEKREIRALEINW---MNSENV--ELSPQMREHSPRLF-------DIGPNGRFTVPVIHV 131
            :||.|:.........|||   .:|:::  ::...:..|..:|.       :.|.|..     ::|
plant    25 VLGETNPSDSSFVTPINWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAE-----VNV 84

  Fly   132 GEHCRK----------TVFIEAGTHAREWISVSTALNCIYQLTERY---TRNIEVLR----KLRF 179
            ..:||.          .:.:..|.|.||.|:...|...:..|:|..   .:|..:|:    ||..
plant    85 VTYCRGGKESDDRSNFRILLTFGQHGRELITSELAFRILSILSEEQFLPNKNGGILKNTLDKLVI 149

  Fly   180 IIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNS-----GPSKINRNTYKG 239
            .:||:.||:|.:...:.:...|:|.|        |.|.|||:.:.|..     .||:.|    .|
plant   150 KMVPIENPNGRKRVESGDLCERRNGR--------GVDLNRNWGVDWGKKEKDYDPSEEN----PG 202

  Fly   240 ESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNP-----------------I 287
            .:|||||||:.||.:  .:|.:...::::||..:::..|:.:....|                 .
plant   203 TAPFSEPETQIMRKL--AISFDPHIWINVHSGMEALFMPYDHKNITPEGLPSQKMRTLLEKLNKF 265

  Fly   288 YWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMEL 346
            :..:...:.:.|              ||:..|..    |:..||:|.|:|.|||...|:
plant   266 HCHDRCMIGSGG--------------GSVGYLAH----GTATDYIYDVVKAPMAFTFEI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 72/319 (23%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 58/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.