DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Cpb1

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_083982.1 Gene:Cpb1 / 76703 MGIID:1923953 Length:415 Species:Mus musculus


Alignment Length:400 Identity:104/400 - (26%)
Similarity:170/400 - (42%) Gaps:58/400 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPKQGTRLALLVVERLHLNIKCQTAKDRSRTDATTALRRLVIPRPDILHTYLDYKQVNQYLQYLA 68
            ||...|::..|.....|  :|.:...|                    :..:|:..:|  ..:.|.
Mouse    52 KPDSATQVKPLTTVDFH--VKAEDVVD--------------------VENFLEENEV--LYEVLI 92

  Fly    69 QRYAHFV------HVHILGHTHEKREIRALEINWMNSENVEL-SPQMREHSPRLFD---IGP--N 121
            ....|.:      |....||::.|..      ||   |.:|. ..|:...:|.|..   ||.  .
Mouse    93 SNVKHILESQFDSHTRASGHSYTKYN------NW---ETIEAWIQQVANDNPDLVSKRVIGTTFE 148

  Fly   122 GRFTVPVIHVGEH--CRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVLR---KLRFII 181
            || .:.|:.:|:.  .:...||:.|.|||||||.:.....:.:....|.:.|.:.|   :|.|.:
Mouse   149 GR-NMYVLKIGKDRPNKPAFFIDCGFHAREWISPAFCQWFVREAVRTYKQEIHMKRLLDELDFYV 212

  Fly   182 VPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFW-NSGPSKIN-RNTYKGESPFS 244
            :|:||.|||.|:..|:..|||.|.....:...|.|.|||:|..| ..|.|:.. .:||.|.:|.|
Mouse   213 LPVVNIDGYVYTWAKDRMWRKTRSTTAGSSCFGVDPNRNFDAGWCEVGASRSPCSDTYCGPTPES 277

  Fly   245 EPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNGR 309
            |.||:|:...:.:..|::..:|::|||.|.::||:.|....|..:.||::|.......:.:.:|.
Mouse   278 EKETKALADFIRQNLSSIKAYLTVHSYSQMMLYPYSYDYKLPENYEELNALVKGAAKELSTLHGT 342

  Fly   310 EYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSRE-LGFQPPVEMISQIGHESWYGIRE 373
            :|..|. ...|....||...|:.|. ..:..:...||..:. .||..|...|.|...|:...::.
Mouse   343 KYTYGP-GATTIYPAAGGSDDWAYD-QGIKYSFTFELRDKGFFGFLLPESQIRQTCEETMLAVKY 405

  Fly   374 MCKRSFDLRH 383
            :.  ::.|.|
Mouse   406 IA--NYVLEH 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 95/342 (28%)
Cpb1NP_083982.1 Propep_M14 31..102 CDD:396700 11/73 (15%)
M14_CPB 112..411 CDD:349443 89/312 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.