DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Cpo

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038940238.1 Gene:Cpo / 689717 RGDID:1588771 Length:325 Species:Rattus norvegicus


Alignment Length:321 Identity:68/321 - (21%)
Similarity:122/321 - (38%) Gaps:94/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRF 124
            :.|:::.::::||..:..|.|..|:|...:..|:      |:.|:|                   
  Rat    32 IYQWMRQVSEKYAEVLTQHFLRMTYETWPMHYLK------ESAEIS------------------- 71

  Fly   125 TVPVIHVGEHCRKTVFIEAGTHAREWISVS---------TALNCIYQL------------TERY- 167
                 ....:.:||::|:.|.||..||:.:         :...|:..|            :|.| 
  Rat    72 -----LTSSNSKKTIWIDCGIHASRWIAPAFCQWFLREGSVFTCLLMLNHAIEYLSTLGSSETYF 131

  Fly   168 ----------------------TRNIEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSA 210
                                  .|...:|::|.| :   :|.|| .|:.|  ..|..........
  Rat   132 FPVNWNGIQLAPLQILQNDKDSARIGRLLKELDFXV---LNADGXIYTWT--TAWTLPVGQGYLC 191

  Fly   211 KFVGTDCNRNYDIFWNSGPSKINRNTYKGESPFSEPETRAMRCILD-RMSSNLLFFLSLHSYGQS 274
            ..:||..|.. |:            |:.|..|..|||....:.:.. |...::|.||.:.||||.
  Rat   192 LHIGTPINCQ-DV------------TFCGIEPMLEPELTPSQALQKARGKKDILCFLIMGSYGQL 243

  Fly   275 IMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGV 335
            |:.|:|:.::.|..:.||..:......|:|:.:|..||.||.:.:. ..::||..|:..|:
  Rat   244 ILTPYGHTKNKPHNYEELIQVGQKAARALKAKHGTNYRVGSGADIL-YMLSGSSKDWNGGI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 68/321 (21%)
CpoXP_038940238.1 Peptidase_M14_like 22..324 CDD:416253 68/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.