DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Cpa3

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_062173.1 Gene:Cpa3 / 54242 RGDID:2390 Length:417 Species:Rattus norvegicus


Alignment Length:341 Identity:89/341 - (26%)
Similarity:160/341 - (46%) Gaps:48/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HTYLDYKQVNQYLQY---LAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSP 113
            |:|..|...|:.:.:   :.:::...|....:|.|.|...:..|:|...:.|             
  Rat   114 HSYAKYNDWNKIVSWTEKMVEKHPEMVSRIKIGSTVEDNPLYVLKIGRKDGE------------- 165

  Fly   114 RLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRN---IEVLR 175
                                  ||.:|::.|.|||||:|.:.....:||..:.|.:|   .::|.
  Rat   166 ----------------------RKAIFMDCGIHAREWVSPAFCQWFVYQAAKSYGKNKIMTKLLD 208

  Fly   176 KLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN--RNTYK 238
            ::.|.::|:.|.|||.:|.||:..|||||..:.::..:|||.|||:|:.|:|.|:..|  .:.|:
  Rat   209 RMNFYVLPVFNVDGYIWSWTKDRMWRKNRSKNPNSTCIGTDLNRNFDVSWDSSPNTDNPCLSVYR 273

  Fly   239 GESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAI 303
            |.:|.||.||:|:...:....:::..:::.|||.|.:::|:||....|...::|..:|......:
  Rat   274 GPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLFPYGYTIKLPPNHQDLLKVARIATDVL 338

  Fly   304 KSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSR-ELGFQPPVEMISQIGHES 367
            .|.....|..|.|:....:| :||.:|:.|. |.:......||..: :.||..|...|.....|:
  Rat   339 SSRYETRYIYGPIASTIYKT-SGSSLDWAYD-LGIKHTFAFELRDKGKSGFLLPESRIKPTCKET 401

  Fly   368 WYGIREMCKRSFDLRH 383
            ...::.:.|  :.|:|
  Rat   402 MLSVKFIAK--YILKH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 85/331 (26%)
Cpa3NP_062173.1 Propep_M14 28..102 CDD:280416
Peptidase_M14_like 114..413 CDD:299699 87/337 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.