DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Cpa4

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001102816.1 Gene:Cpa4 / 502736 RGDID:1563619 Length:421 Species:Rattus norvegicus


Alignment Length:305 Identity:90/305 - (29%)
Similarity:137/305 - (44%) Gaps:54/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVFIEAG 144
            :|.|.|||.:..|:                      |..|..|:           .|..:::.||
  Rat   148 IGETFEKRPMYVLK----------------------FSTGGGGK-----------KRPAIWLNAG 179

  Fly   145 THAREWISVSTALNCIYQLTERYTRN---IEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRP 206
            .|||||||.:||:....::...|.::   ..:|.|:...::|:.|||||.|::.:|..|||.|..
  Rat   180 IHAREWISQATAIWTARKIVTDYQKDPAVTSILEKMDIFLLPVANPDGYVYTQNQNRLWRKTRSR 244

  Fly   207 HKSAKFVGTDCNRNYDIFWN---SGPSKINR---NTYKGESPFSEPETRAMRCILDRMSSNLLFF 265
            :..::.:|.|.|||    ||   :|....|.   ..|.|..|.||.|.:::...:.: ..|...|
  Rat   245 NPGSRCIGADPNRN----WNASFAGEGASNNPCSEVYHGSHPNSEVEVKSVVDFIQK-HGNFKCF 304

  Fly   266 LSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVD 330
            :.||||.|.:|||:||.........||..:|.|...|:.|.:|.:|:.|. :|.|....:||.||
  Rat   305 IDLHSYSQLLMYPYGYSVKKAPDAEELDDVARSAAKALASLSGTKYQVGP-TCTTVYPASGSSVD 368

  Fly   331 YVY--GVLKVPMALVMEL-PSRELGFQPPVEMISQIGHESWYGIR 372
            :.|  |   :..|...|| .:...||..|...|.....|:|.|::
  Rat   369 WAYDNG---IKYAFTFELRDTGHYGFLLPASQIIPTAEETWQGLK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 90/305 (30%)
Cpa4NP_001102816.1 Propep_M14 28..99 CDD:280416
Peptidase_M14_like 117..419 CDD:299699 90/305 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.