DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpa1

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001107681.1 Gene:cpa1 / 497006 XenbaseID:XB-GENE-960032 Length:420 Species:Xenopus tropicalis


Alignment Length:335 Identity:85/335 - (25%)
Similarity:149/335 - (44%) Gaps:49/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118
            |..:.::|.::..|.....:.|....:|.::|.|.:..|:                      |..
 Frog   124 YHTFDEINAFIDNLVSENPNLVSKIQIGSSYEGRPLNVLK----------------------FST 166

  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRN---IEVLRKLRFI 180
            |||              |...:|:.|.|:|||::.::|:....::...:.::   ...|.::..:
 Frog   167 GPN--------------RPAFWIDTGIHSREWVTQASAVWFAKKIVTDFGKDPSLTNTLNQMDIL 217

  Fly   181 IVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN--RNTYKGESPF 243
            |..:.||||:.|:...:..|||.|.|:..:..||||.|||:|..:....|..|  ..||:|.:..
 Frog   218 IEIVTNPDGFVYTHKSDRMWRKTRSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAH 282

  Fly   244 SEPETRAMRCILDRMSS--NLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSY 306
            ||||.:|   |:|.:.|  |:..|:|:|||.|.:::|:||.........||::::....:|:.|.
 Frog   283 SEPEVKA---IVDFVKSHGNIKGFVSIHSYSQMLLFPYGYTNTRVPDHDELNAVSKKAITALASL 344

  Fly   307 NGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMEL-PSRELGFQPPVEMISQIGHESWYG 370
            .|..|..||| ..|....:|..:|:.|. ..:..:...|| .:...||..|...|.....|:|..
 Frog   345 YGTAYTYGSI-ISTIYQASGGTIDWTYN-QGIKHSYSFELRDTGRYGFALPANQIIPTAEETWLA 407

  Fly   371 IREMCKRSFD 380
            :..:.:.:.|
 Frog   408 LTILIEHTRD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 84/330 (25%)
cpa1NP_001107681.1 Propep_M14 27..99 CDD:280416
MpaA 28..402 CDD:225421 82/318 (26%)
M14_CPA 119..418 CDD:133081 85/335 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.