DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpb1

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:312 Identity:89/312 - (28%)
Similarity:152/312 - (48%) Gaps:40/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 HTHEKREIRALEINWMNSENVELSPQMREHSPRLF---DIGPN--GRFTVPVIHVGEH--CRKTV 139
            |::||..    :::.:|:.:..::.|    :|.|.   .||.:  || .:.::.||:.  .:|.|
 Frog   111 HSYEKYN----DLDTINAWSANIAAQ----NPGLVSRSSIGTSYQGR-PIYLLKVGKSGANKKAV 166

  Fly   140 FIEAGTHAREWIS-------VSTALNCIYQLTERYTRNIEVLRKLRFIIVPLVNPDGYEYSRTKN 197
            ||:.|.|||||||       |..|::. |.:...:|   .:|..|...::|::|.|||.|:.|.|
 Frog   167 FIDCGFHAREWISPAFCQWFVKEAVSA-YGVESEFT---SLLDNLDIYVLPVLNVDGYVYTWTTN 227

  Fly   198 PKWRKNRRPHKSAKFVGTDCNRNYDIFW-NSGPS-KINRNTYKGESPFSEPETRAMRCILDRMSS 260
            ..|||.|..:.::..:|||.|||::..| .:|.| :....||.|.:|.|||||:|:...:.....
 Frog   228 RMWRKTRSANPNSTCIGTDPNRNFNAGWCTAGASTRACDETYCGSAPESEPETKALANFIRANIP 292

  Fly   261 NLLFFLSLHSYGQSIMYPWGY----CRDNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTK 321
            .:..:|::|||.|.:::|:.|    .:|:    .||:::|....:::.|....:|..|. ...|.
 Frog   293 AIKGYLTIHSYSQMLLFPYSYSYAVAKDH----NELNAVAQGAVNSLTSLYKTKYTYGP-GGSTI 352

  Fly   322 RTIAGSVVDYVYGVLKVPMALVMEL-PSRELGFQPPVEMISQIGHESWYGIR 372
            ...||...|:.|.. .|..:...|| .:...||..|...|.....|:...::
 Frog   353 YLAAGGSDDWAYDA-GVKFSYTFELRDTGRYGFALPESQIKPTCEETMLAVK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 89/312 (29%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700
M14_CPB 111..410 CDD:349443 89/312 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.