DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpa2

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001003446.2 Gene:cpa2 / 445052 ZFINID:ZDB-GENE-040801-182 Length:422 Species:Danio rerio


Alignment Length:334 Identity:93/334 - (27%)
Similarity:147/334 - (44%) Gaps:57/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118
            |.|...:..::..|...:::.:....:|.|:|.|.:..|:                      |..
Zfish   120 YHDLDTIYSFMDTLVASHSNLISKVKIGSTYENRPMYVLK----------------------FST 162

  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRN----IEVLRKLRF 179
            |            ||: :..::|:||.|||||:|.::|:....::...:..|    ..||.|:..
Zfish   163 G------------GEN-KPAIWIDAGIHAREWVSHASAVWIADRIATDFKENRALARNVLSKMDI 214

  Fly   180 IIVPLVNPDGYEYSR-TKNP---KWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN---RNTY 237
            .::.:.|||||.:|. |..|   .|||:|....:....|.|.|||:|..: |||...:   ...|
Zfish   215 YLMIVANPDGYVFSHLTVRPFHRLWRKSRSVTSNPNCPGVDLNRNFDAEF-SGPGASDDPCAEDY 278

  Fly   238 KGESPFSEPE-TRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKS 301
            :|.|..||.| |.....||..  .|...|::||:|.|.:|||:||...|.....:|..:|.....
Zfish   279 RGPSAHSEIEVTNIADFILSH--GNFKSFMTLHAYSQLLMYPYGYTGSNAPDQPDLHDVATQANK 341

  Fly   302 AIKSYNGREYRTGSISCLTKRTIAGSVVDYVY--GVLKVPMALVMEL-PSRELGFQPPVEMISQI 363
            |:.|::|..|:.||| ..|....:|:.||:.|  |   :......|| .:.|.||..|.:.|...
Zfish   342 ALNSWHGTIYKVGSI-FHTIEQASGASVDWAYQHG---IKYCFAFELRDTGEYGFLLPADQIVST 402

  Fly   364 GHESWYGIR 372
            ..|:|:.:|
Zfish   403 ARETWFALR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 93/334 (28%)
cpa2NP_001003446.2 Propep_M14 27..97 CDD:280416
Peptidase_M14_like 115..420 CDD:299699 93/334 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.