DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpa4

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001002217.1 Gene:cpa4 / 431764 ZFINID:ZDB-GENE-040704-61 Length:417 Species:Danio rerio


Alignment Length:334 Identity:93/334 - (27%)
Similarity:152/334 - (45%) Gaps:58/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118
            |.|...:..::..|...:.:.:....:|:::|.|.:.||:                      |..
Zfish   120 YHDLDTIYSFMDTLVASHPNLISKINIGNSYENRPMYALK----------------------FST 162

  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEV---LRKLRFI 180
            |            ||: |..::|:||.|||||::.::|:....::...|..:..|   |.::...
Zfish   163 G------------GEN-RPAIWIDAGIHAREWVTQASAVWIANKMASDYGVDPSVTSLLGQMDVY 214

  Fly   181 IVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDI-FWNSGPSKIN--RNTYKGESP 242
            ::.:.|||||.::.|.|..|||.|..:..:...|||.|||:|. |...|.|| |  .::|.|  |
Zfish   215 LMIVTNPDGYSFTHTDNRMWRKTRSVNPGSSCRGTDPNRNWDAGFGGPGASK-NPCSDSYHG--P 276

  Fly   243 FSEPETRAMRCI-LDRMSSNLLFFLSLHSYGQSIMYPWGY-CRDNPIYWRELSSLANSGKSAIKS 305
            ::..|......: |.:...|...|:|:|||.|.:|||:|| |.:.|    :.|.|...|.:|||.
Zfish   277 YAHSEVEVKNVVDLIKGHGNFKSFISIHSYSQLLMYPYGYTCTNIP----DQSELHAVGTAAIKE 337

  Fly   306 ----YNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSREL-GFQPPVEMISQIGH 365
                || .:|:.||| |......:|..:|:.|.: .:..:...||....| ||..|...|.....
Zfish   338 LMSLYN-TKYQVGSI-CKIIYQASGGSIDWTYNI-GIKYSFAFELRDTGLYGFLLPANQIIPTAE 399

  Fly   366 ESWYGIREM 374
            |:|.|::.:
Zfish   400 ETWLGLKNI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 93/334 (28%)
cpa4NP_001002217.1 Propep_M14 27..97 CDD:280416
M14_CPA 115..415 CDD:133081 93/334 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.