DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and CG8560

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster


Alignment Length:326 Identity:123/326 - (37%)
Similarity:174/326 - (53%) Gaps:37/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPN 121
            :.::|.||..||..|...|.|.:.|.::|.|:|:.:.|.                         |
  Fly   126 HAEINAYLDELAAAYPSRVSVQVAGKSYENRDIKTITIT-------------------------N 165

  Fly   122 GRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVLRKLRFIIVPLVN 186
            |.        |:..:..||::||.||||||:.:.||..|:||.|.:..|.|:|:...::|:|:||
  Fly   166 GD--------GKTGKNVVFLDAGIHAREWIAHAGALYVIHQLVENFAANSELLKDFDWVILPVVN 222

  Fly   187 PDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNS-GPSKIN-RNTYKGESPFSEPETR 249
            |||||||.|....|||.|:|..||.: |||.|||:|..|.. |.|..: .:|:|||:.||||||:
  Fly   223 PDGYEYSHTTTRMWRKTRKPISSACY-GTDANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQ 286

  Fly   250 AMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNGREYRTG 314
            .:|.||..::....|:|:|||||..::||||:....|..||:...:|..|..||||..|.:|..|
  Fly   287 LIRDILLSLTGRGKFYLTLHSYGNYLLYPWGWTSALPSSWRDNDEVAQGGADAIKSATGTKYTVG 351

  Fly   315 SISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSRELGFQPPVEMISQIGHESWYGIREMCKRSF 379
            | |.......||...||.:||...|:::.||||:...||.|....|.....|:|.||:.|.::..
  Fly   352 S-STNVLYAAAGGSDDYAFGVANFPVSITMELPAGGTGFNPSTSQIEGFVSETWVGIKAMAQKVA 415

  Fly   380 D 380
            |
  Fly   416 D 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 122/321 (38%)
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416
M14_CP_A-B_like 123..414 CDD:199844 122/322 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.