DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and CG18417

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648119.1 Gene:CG18417 / 38829 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster


Alignment Length:352 Identity:107/352 - (30%)
Similarity:165/352 - (46%) Gaps:41/352 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SRTDATTALRRLVIPRPDILHT--YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEI 94
            ||...|..:.|...|....|.|  |.:::::||:::.||..:...|.:..:|.::|.|.::.:.|
  Fly   103 SRQFETNRMLRHWFPYNGRLGTERYYNHEEINQFIEDLAGEHPRRVFLKTVGRSYEGRWLKTITI 167

  Fly    95 NWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNC 159
            .                         ||.        ....:..:.::.|.|||||||.:.|...
  Fly   168 T-------------------------NGD--------ARRNKNVILVDGGFHAREWISPAAATYL 199

  Fly   160 IYQLTERYTRNIEVLRKLRFIIVPLVNPDGYEYSRTKNP--KWRKNRRPHKSAKFVGTDCNRNYD 222
            |.||......|.::|....::|:|:||||||||::....  .|||.|:| .|:..:|||.|||:|
  Fly   200 INQLVYNLEDNADLLLDFDWVILPVVNPDGYEYTQLSEDTRMWRKTRKP-SSSDCIGTDPNRNFD 263

  Fly   223 IFWNSGPSKIN--RNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDN 285
            ..||...:..:  .|.|.|..||||||...:..::.........:|:|||||..|:||||:....
  Fly   264 FHWNEEGASDDPCDNIYAGAKPFSEPEALVVGDLIHSYVDRGQMYLTLHSYGSLILYPWGWTAAV 328

  Fly   286 PIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSRE 350
            |....:|..:|.:|:|||:...|..|:.|..:.......:|:..||.:.. ..|::..||||...
  Fly   329 PDTEEDLHEVAAAGQSAIQEATGTIYKIGPSATTINYAASGASDDYAFNA-GFPISFTMELPFGG 392

  Fly   351 LGFQPPVEMISQIGHESWYGIREMCKR 377
            .||.||...|..|..|:|.||..|.::
  Fly   393 TGFDPPASDIDSIVKETWVGIAAMARK 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 100/326 (31%)
CG18417NP_648119.1 Propep_M14 <65..99 CDD:280416
M14_CP_A-B_like 127..420 CDD:199844 100/328 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.