DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and CG8563

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster


Alignment Length:364 Identity:117/364 - (32%)
Similarity:167/364 - (45%) Gaps:55/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KCQTA-KDRSRTDATTALRRLVIPRPDILHTYLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKR 87
            :|:.| :.|.||      ||..  |....| |..|.:|..::..||.||..|.....||.::|.|
  Fly   124 ECEQAERPRRRT------RRQA--RGFFSH-YPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGR 179

  Fly    88 EIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWIS 152
            .|.||.|    |.|..:.|                             |:..:|:|.||.||||:
  Fly   180 HIAALSI----SLNSRVRP-----------------------------RRVAYIQAATHGREWIT 211

  Fly   153 VSTALNCIYQLTERYTRNIEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDC 217
            ..|.|...|:|.........||:.:...:|||||||||||:.|.:..|||||..:......|.|.
  Fly   212 TQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYEYTHTTDRFWRKNRHRYAGHSCSGVDI 276

  Fly   218 NRNYDIFWN-SGPSK-INRNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWG 280
            |||:...|| .|.|: :....|.|.:|.|||||.|:...|:...:.:...|.:||:|:.|.||:|
  Fly   277 NRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYG 341

  Fly   281 YCRDN-PIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVM 344
            |.::. |.....|.|:|....:.|..|.|..|.||:.:.:.... :||:.|:.||.|.:|::..:
  Fly   342 YAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEA-SGSLDDFAYGNLGIPLSYTL 405

  Fly   345 ELPSRELGFQPPVEMISQIGHESWYGIREMCKRSFDLRH 383
            |||..|  |..|...|..:..|::.|..|.      :||
  Fly   406 ELPGDE--FHVPAHDIIHVCKETFAGFIEF------IRH 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 106/325 (33%)
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 108/333 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.