DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and CG12374

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster


Alignment Length:319 Identity:81/319 - (25%)
Similarity:147/319 - (46%) Gaps:49/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AH-FVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHC 135
            || |:...::|.::|.|:|:::.:: ..|.|                                  
  Fly   134 AHDFLECKVIGQSYEGRDIKSIRLS-KRSGN---------------------------------- 163

  Fly   136 RKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVL-RKLRFIIVPLVNPDGYEYSRTKNPK 199
             |.:|:|...||.||||.:|....:.||.......::.| .:..:|:||:|||||:.|:......
  Fly   164 -KAIFLEGNIHAMEWISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERL 227

  Fly   200 WRKNRRP----HKSAKFVGTDCNRNYDIFWNSGPSKINR---NTYKGESPFSEPETRAMRCILDR 257
            |||||||    ::|....|.|.|||:|..|......|:.   :.:.||.|.:|.|..:::..:..
  Fly   228 WRKNRRPNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSS 292

  Fly   258 MSSNLL-FFLSLHSYGQSIMYPWGYCR-DNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLT 320
            .....: .:::.|:|||.::.|:|:.. :.|..:.::..:|.:...|.....|..:..|: |.|.
  Fly   293 FEDGYIRSYMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGSTFTYGA-SGLL 356

  Fly   321 KRTIAGSVVDYVYGVLKVPMALVMELPSR-ELGFQPPVEMISQIGHESWYGIREMCKRS 378
            ...::|:..|:.|||.|:|....:||..: ..||..|...|:::|.|...|::.:..::
  Fly   357 NYVVSGAAKDWAYGVKKIPFTCTVELRDKGTFGFFLPSNQITEVGLEVTAGLKALVNKA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 81/316 (26%)
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 81/317 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.