DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and CG7025

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster


Alignment Length:342 Identity:94/342 - (27%)
Similarity:158/342 - (46%) Gaps:58/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118
            |....::..:|..:...|.......|:|.::|.|.||.::|::            :.::|     
  Fly   123 YNSLAEIYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISY------------KSNNP----- 170

  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVLRKLR----F 179
                               .|.||:..||||||:.:||   .:.:.|..|...|::|.|.    :
  Fly   171 -------------------GVLIESNIHAREWITSATA---TWLINEFLTSTDELVRDLAENHDW 213

  Fly   180 IIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFW--NSGPSKIN--RNTYKGE 240
            .|||::|.||:.|:..|:..|||.|:|.:.:..:|.|.|||||..|  |.|.|. |  ...|.|.
  Fly   214 YIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASS-NPCAEDYGGP 277

  Fly   241 SPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDN-PIYWRELSSLANSGKSAIK 304
            .||||||.:||...:..:...:...|:.|||.|.::.|:|:.::. |..:.::..:|.:...|::
  Fly   278 KPFSEPEIQAMSEFVISIKDKINVLLAFHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGDAVE 342

  Fly   305 SY-NGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSRELG----FQPPVEMISQIG 364
            |. .|..||.||.:.:. ...:|:.:|:.|....|.::..:|.  |:.|    ..|||.:|.. .
  Fly   343 SLPYGTVYRYGSAAGIL-YPASGATIDWAYNEQGVEISYTIEF--RDTGRYGFILPPVHIIPN-A 403

  Fly   365 HESWYGIREMCKRSFDL 381
            .|:..||..:.::..||
  Fly   404 EEALIGIAALLEKCKDL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 92/336 (27%)
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416
M14_CP_A-B_like 123..416 CDD:199844 92/336 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.