DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and CG18585

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster


Alignment Length:337 Identity:92/337 - (27%)
Similarity:162/337 - (48%) Gaps:48/337 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118
            |.:.:::..:|..:...|.......|:|.::|.|.||.::|:               |.     .
  Fly   122 YYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKIS---------------HK-----A 166

  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVLR-KLRFIIV 182
            |..|                :|||:..||||||:.::|...|.||......::..|. ...:.|:
  Fly   167 GNPG----------------IFIESNIHAREWITSASATWFINQLLTSEDADVRSLADNYDWHII 215

  Fly   183 PLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFW--NSGPSKIN--RNTYKGESPF 243
            |:.|.||:|||..|:..|||.|:||.:...:|.|.|||:|.:|  |:|.|. |  ..|:.|::|.
  Fly   216 PVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNNGASD-NPCSETFAGDNPE 279

  Fly   244 SEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDN-PIYWRELSSLANSGKSAIKSY- 306
            ||||.:|:...|.::...:..::|.|||||.::.|:|:..:. |..:.::.::..:...||::. 
  Fly   280 SEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALP 344

  Fly   307 NGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSR-ELGF-QPPVEMISQIGHESWY 369
            .|..|:.||.:.:. ....|:.||:|:..|...:...:|...: ..|| .|||::|... .|...
  Fly   345 YGTVYQYGSTADVL-YVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQIIPNC-EELMV 407

  Fly   370 GIREMCKRSFDL 381
            |:..:.:::.:|
  Fly   408 GMLALIEKTKEL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 91/331 (27%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 122..415 CDD:199844 91/331 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.