DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and CG8945

DIOPT Version :10

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster


Alignment Length:62 Identity:16/62 - (25%)
Similarity:28/62 - (45%) Gaps:3/62 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 NAHCLSLTQSLSQSS---TVESSFPNLNLGSDSVSSRFPFPKIQVKAGMMVFDERSESDSSS 177
            |::.|...||.|||:   .:.|.|..:...:.:.::......:|....|.|..||.:.:.||
  Fly   167 NSNALPSQQSSSQSAAGGNLLSLFGLMPTPAPTTTTTTEASPVQKIMNMFVPQERPQPEQSS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 Peptidase_M14 60..370 CDD:459730 16/62 (26%)
CG8945NP_573190.1 PHA03175 396..>525 CDD:177551
Propep_M14 987..1061 CDD:460505
Peptidase_M14 1095..1421 CDD:459730
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.