DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and CG8945

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster


Alignment Length:273 Identity:69/273 - (25%)
Similarity:116/273 - (42%) Gaps:57/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RLVIPRPDILHTYLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEIN------WMNSE 100
            |...|.|...:.|.::.::.:||:.:..|:...|.:..:|.:.|.|.:..::|.      ..|::
  Fly  1077 RPTAPPPMTWNRYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVVKIESKQTAAAANND 1141

  Fly   101 NVEL--SPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQL 163
            .:..  .|:.:..|.:                     ...||:|||.....||..:.|...|.:|
  Fly  1142 GLHTIKRPKRKRKSGQ---------------------ANAVFVEAGAQGLAWIGPAAATWMIAEL 1185

  Fly   164 -----TERYTRNIEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAK------------ 211
                 |.:...::|.:|...:.|:|::|||||.||...:..|:|:|..|::..            
  Fly  1186 LRLMKTNKSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWL 1250

  Fly   212 ---------FVGTDCNRNYDIFWNS-GPSKINRNT-YKGESPFSEPETRAMRCILDRMSSNLLFF 265
                     ..|.|.:||:...|.. |.||...|. |.|.:|||||||:|:...|....:.:..:
  Fly  1251 QQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLY 1315

  Fly   266 LSLHSYGQSIMYP 278
            :||.:|||.|.||
  Fly  1316 ISLQAYGQVISYP 1328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 66/261 (25%)
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 66/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.