DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpa1

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001018318.1 Gene:cpa1 / 325886 ZFINID:ZDB-GENE-050522-438 Length:418 Species:Danio rerio


Alignment Length:373 Identity:97/373 - (26%)
Similarity:157/373 - (42%) Gaps:56/373 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALLVVERLHLNIKCQTAKDRSRTDATTALRRLVIPR--PDILH-TYLDYKQVNQYLQYLAQRYAH 73
            |.|...::..:|..:..:|....:....|:....||  .|.:: ||.|...:|.::..|.....:
Zfish    77 AFLAYNQIPYHIMIENVQDLVDKEQLQMLKYHGFPRSTDDFVYTTYHDLDSINLFMDMLVAENQN 141

  Fly    74 FVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKT 138
            .|....:|.::|.|.:..|:                      |..|.|              |..
Zfish   142 MVSKIEIGQSYENRPLNVLK----------------------FSTGAN--------------RPG 170

  Fly   139 VFIEAGTHAREWISVSTALNCIYQLTERYTRN---IEVLRKLRFIIVPLVNPDGYEYSRTKNPKW 200
            ::|:.|.|:||||:.::.:....::...|.|:   .::|......:..:.||||..|:.:.:..|
Zfish   171 IWIDTGLHSREWITHASGIWFAKKIVTDYGRDPVLTDILNSYDIFLEIVANPDGLAYTHSDDRMW 235

  Fly   201 RKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN--RNTYKGESPFSEPETRAMRCILDRMSS--N 261
            ||.|:|:..:..||.|.|||::..:....|..|  ..||.|.|..||||.:|   |::.:.|  |
Zfish   236 RKTRKPNPGSSCVGVDPNRNWETGFGGPGSSSNPCSQTYHGPSIHSEPEVKA---IVEFVKSHGN 297

  Fly   262 LLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAG 326
            |..|||:|||.|.::||:||.:.......||..||....|.::|.....|..||| ..|.....|
Zfish   298 LKAFLSIHSYSQMLLYPYGYTQTAAKDQAELHELARKATSELQSLYNTAYTYGSI-ITTIYQADG 361

  Fly   327 SVVDYVY--GVLKVPMALVMEL-PSRELGFQPPVEMISQIGHESWYGI 371
            ...|:.|  |   :..:...|| .:...||..|.:.|.....|:|..:
Zfish   362 VTTDWAYEQG---IKYSYTFELRDTGRYGFILPADQILPTAEETWLAL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 88/328 (27%)
cpa1NP_001018318.1 Propep_M14 27..99 CDD:280416 4/21 (19%)
Peptidase_M14_like 117..416 CDD:299699 89/333 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.