DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpb1

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001315354.1 Gene:cpb1 / 322412 ZFINID:ZDB-GENE-030131-1132 Length:416 Species:Danio rerio


Alignment Length:333 Identity:82/333 - (24%)
Similarity:141/333 - (42%) Gaps:51/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HTYLDYKQ---VNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSP 113
            |.|..|..   :|.:...::......:....:|:|:|.|.:..|:|......|            
Zfish   112 HDYTKYNSWATINDWAISISSANPDLISRQSIGNTYEGRTMHLLKIGKNTGSN------------ 164

  Fly   114 RLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRN---IEVLR 175
                                  :..||::.|.||||||:.:.....:.:....|..:   ..:|.
Zfish   165 ----------------------KPAVFMDCGFHAREWITHAFCQWFVNEAVSTYGSDPDMTNLLD 207

  Fly   176 KLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFW-----NSGPSKINRN 235
            ::.|.::|:.|.|||||:..::..|||.|..:..:..:|||.|||::..|     :|.|..   :
Zfish   208 RMDFFVLPVFNIDGYEYTWNRDRMWRKTRSKNSGSSCIGTDPNRNFNAGWCTVGASSNPCS---D 269

  Fly   236 TYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGK 300
            ||.|.||.||.|::.:...:....|.:..:|::|||.|.:::|:.|..|...:..||.|::....
Zfish   270 TYCGSSPESEIESKNLANFIRTNKSVIKAYLTVHSYSQLLLFPYSYKYDLAAHHSELMSVSQGAI 334

  Fly   301 SAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSR-ELGFQPPVEMISQIG 364
            :|::|..|.:|.:|. ...|....||...|:.|. |.|..:...||... ..||..|...|....
Zfish   335 AALRSLYGTKYTSGP-GAATIYPAAGGSDDWAYD-LGVKYSYTFELRDEGRYGFLLPESQIKPTC 397

  Fly   365 HESWYGIR 372
            .|:...::
Zfish   398 EETMLAVK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 81/331 (24%)
cpb1NP_001315354.1 M14_CPB 112..412 CDD:199852 82/333 (25%)
Propep_M14 27..99 CDD:280416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.