DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Cpa6

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:281 Identity:82/281 - (29%)
Similarity:135/281 - (48%) Gaps:32/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RLFDIGPN--GRFTVPVIHVGEHC---RKTVFIEAGTHAREWIS-------VSTALNCIYQLTER 166
            |:|.||.:  || ::.:|.:|...   ::.|:|:.|.||||||.       |..|:  :...|:.
  Rat    13 RVFPIGRSFEGR-SLLIIQLGRKSQVYKRAVWIDCGIHAREWIGPAFCQWFVKEAI--LTYKTDP 74

  Fly   167 YTRNIEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFW-----N 226
            ..|  ::|..|.|.|:|::|.|||.:|.|.:..|||.|..:......|.|.|||:.:.|     :
  Rat    75 AMR--KMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRGVDANRNWKVKWCDEGAS 137

  Fly   227 SGPSKINRNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRE 291
            :.|..   :||.|..|.||||.:|:...|.:....:..:||.|:|.|.::||:.|.......:..
  Rat   138 ADPCD---DTYCGPFPESEPEVKAVANFLRKHRKRIRAYLSFHAYAQMLLYPYSYKHATIPNFSC 199

  Fly   292 LSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVY--GVLKVPMALVMEL-PSRELGF 353
            :...|:....|::|.:|..||.|..| .|....:|:.:|:.|  |   :|.:...|| .:...||
  Rat   200 VEFAAHKAVKALRSVHGIRYRHGPAS-QTLYVSSGNSMDWAYKNG---IPYSFAFELRDTGYFGF 260

  Fly   354 QPPVEMISQIGHESWYGIREM 374
            ..|..:|.....|:...::.:
  Rat   261 LLPEMLIKPTCTETMLAVKNI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 82/281 (29%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 82/281 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.