DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpa5

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_954965.1 Gene:cpa5 / 246092 ZFINID:ZDB-GENE-020514-1 Length:419 Species:Danio rerio


Alignment Length:331 Identity:89/331 - (26%)
Similarity:149/331 - (45%) Gaps:57/331 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TYLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFD 117
            ||.|...:|.::..|.....:.|...::|.::|||.:..|:                      |.
Zfish   122 TYHDLNSINSFMDMLVAENRNMVSKVVIGQSYEKRPLNVLK----------------------FS 164

  Fly   118 IGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRN---IEVLRKLRF 179
            .|.|              |..::|:.|.|:|||::.::.:....::.:.|.|:   .::|.....
Zfish   165 TGAN--------------RPGIWIDTGIHSREWVTQASGVWFAKKIVKDYGRDPVLTDILNSHDI 215

  Fly   180 IIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN--RNTYKGESP 242
            .:..:.||||:.|:.||:..|||.|:|:..:..||.|.|||:|..:..|.|..|  ..||:|.|.
Zfish   216 FLEIVTNPDGFVYTHTKDRMWRKTRKPNPGSSCVGVDPNRNWDAGFGGGGSSNNPCTETYRGPSA 280

  Fly   243 FSEPETRAMRCILDRMSSN--LLFFLSLHSYGQSIMYPWGY----CRDNPIYWRELSSLANSGKS 301
            .||||.:|   |:|.:.|:  :..|:|:|||.|.::||:||    .:|.    .||..:|....:
Zfish   281 HSEPEVKA---IVDFVKSHGKIKAFVSIHSYSQMLLYPYGYTYTAAKDK----AELHEVARKAIT 338

  Fly   302 AIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMEL-PSRELGFQPPVEMISQIGH 365
            :::|.....|..||| ..|....:|..:|:.|. ..:..:...|| .:...||..|...|.....
Zfish   339 SLQSLYNTRYTYGSI-ITTIYQASGGTIDWTYN-QGIKYSYTFELRDTGRYGFILPANQIVPTAE 401

  Fly   366 ESWYGI 371
            |:|..:
Zfish   402 ETWLAL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 88/330 (27%)
cpa5NP_954965.1 Propep_M14 27..100 CDD:280416
Peptidase_M14_like 118..417 CDD:299699 89/331 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.