DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Cpb1

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_036665.2 Gene:Cpb1 / 24271 RGDID:2391 Length:415 Species:Rattus norvegicus


Alignment Length:332 Identity:89/332 - (26%)
Similarity:145/332 - (43%) Gaps:50/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HTYLDYKQ---VNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSP 113
            |:|..|.:   :..::|.:|......|...::|.|.|.|.:..|:|.           :.|.:.|
  Rat   112 HSYTKYNKWETIEAWIQQVATDNPDLVTQSVIGTTFEGRNMYVLKIG-----------KTRPNKP 165

  Fly   114 RLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNI---EVLR 175
                                    .:||:.|.|||||||.:.....:.:....|.:.|   ::|.
  Rat   166 ------------------------AIFIDCGFHAREWISPAFCQWFVREAVRTYNQEIHMKQLLD 206

  Fly   176 KLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFW-NSGPSKIN-RNTYK 238
            :|.|.::|:||.|||.|:.||:..|||.|.....:..:|.|.|||::..| ..|.|:.. ..||.
  Rat   207 ELDFYVLPVVNIDGYVYTWTKDRMWRKTRSTMAGSSCLGVDPNRNFNAGWCEVGASRSPCSETYC 271

  Fly   239 GESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAI 303
            |.:|.||.||:|:...:....|.:..:|::|||.|.::||:.|....|..:.||::|.......:
  Rat   272 GPAPESEKETKALADFIRNNLSTIKAYLTIHSYSQMMLYPYSYDYKLPENYEELNALVKGAAKEL 336

  Fly   304 KSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSRE---LGFQPPVEMISQIGH 365
            .:.:|.:|..|. ...|....||...|:.|. ..:..:...||  |:   .||..|...|.|...
  Rat   337 ATLHGTKYTYGP-GATTIYPAAGGSDDWSYD-QGIKYSFTFEL--RDTGFFGFLLPESQIRQTCE 397

  Fly   366 ESWYGIR 372
            |:...::
  Rat   398 ETMLAVK 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 88/330 (27%)
Cpb1NP_036665.2 Propep_M14 33..102 CDD:396700
M14_CPB 112..410 CDD:349443 89/332 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.