DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and ccpp-6

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_495012.2 Gene:ccpp-6 / 184043 WormBaseID:WBGene00017136 Length:459 Species:Caenorhabditis elegans


Alignment Length:225 Identity:46/225 - (20%)
Similarity:83/225 - (36%) Gaps:72/225 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPN 121
            |.|:..:|..|..|...|.|..:|..|.:||.:..:.|               :.:|..|     
 Worm   146 YGQMQIWLNELESRKYPFFHRDLLVQTVQKRRVDLITI---------------DATPDTF----- 190

  Fly   122 GRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVLRKLR----FIIV 182
                       :..:|.:|:.|..|..|    |.:.:.::.:.|......:..:|||    |.|:
 Worm   191 -----------QGSKKMIFLTARVHPGE----SPSSHVMHGIIEFLVSKDDRAQKLRKVYCFKII 240

  Fly   183 PLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKINRNTYKGESPFSEPE 247
            |::||||.         :..|.|    ...:|.|.||    .|.:            .|.::.|.
 Worm   241 PMLNPDGV---------FLGNYR----CSLMGHDLNR----MWRT------------PSDWAHPS 276

  Fly   248 TRAMRCILDRMSSN----LLFFLSLHSYGQ 273
            ..|::.:|.:..:|    .:.::.||::.|
 Worm   277 IYAVKNLLTQYDNNPQAQTVIYVDLHAHSQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 46/225 (20%)
ccpp-6NP_495012.2 M14_AGBL4_like 153..418 CDD:133118 44/218 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.