DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Y59C2A.1

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_494213.2 Gene:Y59C2A.1 / 173577 WormBaseID:WBGene00021984 Length:454 Species:Caenorhabditis elegans


Alignment Length:382 Identity:110/382 - (28%)
Similarity:172/382 - (45%) Gaps:68/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TRLALLVVERLHLNIKCQTAKDRSRTDATTALRRLVIPRPDILHT--------YLDYKQVNQYLQ 65
            |...|..::.|..:|:.|...:|.     ..:|..|..|...:.|        |..|.::.::::
 Worm    99 TSAELSTLKMLEGDIQSQINAERH-----AMIRNSVRRRKRAMKTWQEFDTNAYHSYNEMVEFMK 158

  Fly    66 YLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIH 130
            .|:::.:..|.:..:..:.|.|.|..::|                |.|     ||    :.|.  
 Worm   159 LLSEQKSDMVEMVKVATSSEGRSIYGVKI----------------HPP-----GP----SPPE-- 196

  Fly   131 VGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEV---LRKLRFIIVPLVNPDGYEY 192
                 :.::.::||.||||||:.:..|..|.::.|.|.||.:|   |:|..:.|:|.||||||||
 Worm   197 -----KPSIIVDAGVHAREWIAPAVGLFMIRKIVEEYGRNPQVTANLQKFDWYIMPQVNPDGYEY 256

  Fly   193 SRTKNPKWRKNRRPHKSAK--FVGTDCNRNYDIFWNSGPSKINR----NTYKGESPFSEPETRAM 251
            |||.:..|||.|..:.:..  .||.|.|||:...|  |.:..||    |.|.|..|:||||.|.:
 Worm   257 SRTTDRLWRKTRSKNVTVNRWCVGADANRNWGYRW--GEAGANRTPCSNIYMGSHPYSEPEIRGL 319

  Fly   252 RCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNGREYRTGSI 316
            :.......:|.:.::|||||||.::.||||..:....:::..:.|.....|||:..|..|..|:|
 Worm   320 KEFFTWQITNPMVYISLHSYGQLLLSPWGYTNERTENYQDQQNAAKEAAQAIKNTTGVSYSYGTI 384

  Fly   317 SCLTKRTIAGSV-------VDYVYGVLKVPMALVMELPSRELGFQPPVEMISQIGHE 366
            |.:.......|:       |.|:|||...|    .:.|: ...|..|...|...|.|
 Worm   385 SEMMYPASGTSIDFMQHRGVPYIYGVELRP----TDNPN-SFAFNLPPSYIRATGDE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 100/329 (30%)
Y59C2A.1NP_494213.2 Propep_M14 <69..120 CDD:366995 5/20 (25%)
M14_CP_A-B_like 147..441 CDD:349433 100/329 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.