DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Y18H1A.9

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_490776.2 Gene:Y18H1A.9 / 171666 WormBaseID:WBGene00021213 Length:488 Species:Caenorhabditis elegans


Alignment Length:398 Identity:118/398 - (29%)
Similarity:177/398 - (44%) Gaps:85/398 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LHTYLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRL 115
            |..|..:..|..||..||..|...|.|..:|.|||.|:|..::|.  |..|              
 Worm   122 LAQYHSFADVINYLNSLAITYPELVSVQPIGTTHEGRQIPLIKIT--NKRN-------------- 170

  Fly   116 FDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEV---LRKL 177
                 .|            .::.::::.|.|||||:|.||.|..|:||..:|.:::::   :.:|
 Worm   171 -----GG------------TKRGIWVDGGIHAREWVSPSTVLYFIHQLVTQYDKDVQIKQFVDQL 218

  Fly   178 RFIIVPLVNPDGYEYSRTKN-PK---WRKNRRPHKSAKFV-------------GTDCNRNYDIFW 225
            .:.||||:|||||||||:.| |:   |||||.|.|..:..             |.|.|||:|.|:
 Worm   219 EWYIVPLLNPDGYEYSRSSNDPEIRLWRKNRSPPKCIQQATGLFQPPTTTCCQGVDLNRNFDWFF 283

  Fly   226 NSGPSKIN--RNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWG-----YCR 283
            ....|..:  ...|:|...||||||.|:|..:.|  ..:..||:.|||.|.:|||:|     |..
 Worm   284 GQVGSSTDPCSEIYQGAYAFSEPETAAVRDFVQR--HRISTFLTFHSYSQILMYPFGHQVRTYSN 346

  Fly   284 DNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMEL-P 347
            |    ..:|.|.|.|...|:.|....:|:.|: ...|....:|...|:..|...|..:.:.|| |
 Worm   347 D----LNDLRSTALSAAQALNSVYNTQYKVGT-GADTLYPASGGSEDWAKGKAHVKYSFLFELRP 406

  Fly   348 SREL--GFQPPVEMISQIGHESWYGIREMCKRSFDLRHQIVREKEPPLPWPSR----HESS---- 402
            ..::  ||......|.....|:|..::.:..::.:|...:.|.       |::    |:|.    
 Worm   407 EEQVWDGFLLAENQIIPTARETWEAVKVIASKTIELPSNMHRA-------PAKRCIDHDSLCPSW 464

  Fly   403 NEGVAIEN 410
            .:|.|.||
 Worm   465 AQGGACEN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 108/352 (31%)
Y18H1A.9NP_490776.2 Propep_M14 29..97 CDD:366995
M14_CP_A-B_like 125..436 CDD:349433 108/350 (31%)
ShKT 454..487 CDD:214586 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.