DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and Cpa3

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus


Alignment Length:410 Identity:112/410 - (27%)
Similarity:196/410 - (47%) Gaps:53/410 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TRLALLVV----ERLHLNIKCQTAKDRSRTDATTALRRLVIPRPDILHTY-----LDYK---QVN 61
            |.||:..|    |:: ..:|.|..|..|.....|....|....||.:|..     :|::   :.:
Mouse    12 TTLAIAPVHFDREKV-FRVKLQNEKHASVLKNLTQSIELDFWYPDAIHDIAVNMTVDFRVSEKES 75

  Fly    62 QYLQYLAQRYAHFVHVHILGHTHEKREIRALEI--------------NWMNSENVELSPQMREHS 112
            |.:|...::  |.:|..||.|..::...:..::              :|  .:.|..:.:|.|..
Mouse    76 QTIQSTLEQ--HKIHYEILIHDLQEEIEKQFDVKDEIAGRHSYAKYNDW--DKIVSWTEKMLEKH 136

  Fly   113 PRL---FDIGPNGRFTVP-----VIHVGEHC--RKTVFIEAGTHAREWISVSTALNCIYQLTERY 167
            |.:   ..||.    ||.     |:.:|:..  ||.:|::.|.|||||||.:.....:||.|:.|
Mouse   137 PEMVSRIKIGS----TVEDNPLYVLKIGKKDGERKAIFMDCGIHAREWISPAFCQWFVYQATKSY 197

  Fly   168 TRN---IEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGP 229
            .:|   .::|.::.|.::|:.|.|||.:|.|::..|||||..::::..:|||.|||:|:.|:|.|
Mouse   198 GKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSWDSSP 262

  Fly   230 --SKINRNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWREL 292
              :|...|.|:|.:|.||.||:|:...:....:::..:::.|||.|.::.|:||....|...::|
Mouse   263 NTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPYGYTFKLPPNHQDL 327

  Fly   293 SSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSR-ELGFQPP 356
            ..:|.....|:.:.....|..|.|:....:| :||.:|:||. |.:......||..: :.||..|
Mouse   328 LKVARIATDALSTRYETRYIYGPIASTIYKT-SGSSLDWVYD-LGIKHTFAFELRDKGKSGFLLP 390

  Fly   357 VEMISQIGHESWYGIREMCK 376
            ...|.....|:...::.:.|
Mouse   391 ESRIKPTCKETMLSVKFIAK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 98/361 (27%)
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 17/75 (23%)
Peptidase_M14_like 114..413 CDD:299699 90/305 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.