DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and LOC105947369

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_012818774.2 Gene:LOC105947369 / 105947369 -ID:- Length:419 Species:Xenopus tropicalis


Alignment Length:369 Identity:94/369 - (25%)
Similarity:164/369 - (44%) Gaps:54/369 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVVERLHLNIKCQTAKDRSRTDATTALRRLVIPRPDILHTYLDYKQVNQYLQYLAQRYAHFVHVH 78
            ::.:.|...|:.|.:|..:..|     .|...||      |..:.:::.:...::.:|.:.|.|.
 Frog    92 ILFQNLQEAIENQLSKAGNPKD-----ERFPSPR------YRTWLEISTWAYRVSVKYPNLVSVV 145

  Fly    79 ILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVFIEA 143
            ..|:|:|.:.|..|::...::.                                   :|.:.:|.
 Frog   146 QAGNTYEGQTILVLKVGSQSAH-----------------------------------KKGIVLEC 175

  Fly   144 GTHAREWISVSTALNCIYQLTERYTRN---IEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRR 205
            |.|||||||.:.....:.:....|.::   .::|..:.|.:||:.|.|||.::.|.:..|||||.
 Frog   176 GVHAREWISPAFCQWFVNEAIRSYGKDKAMTKLLNSVTFHVVPVFNVDGYIWTWTHDRMWRKNRY 240

  Fly   206 PHKSAKFVGTDCNRNYDIFWNSGPSKIN--RNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSL 268
            ...:.|.||.|.|||::..|.:|.|...  ...|.|..|.||.||:|:...:....|:|..::|.
 Frog   241 QDANNKCVGVDLNRNFNASWGTGFSNDEPCSEIYAGSGPESENETKAVASYIRDNISSLKAYISF 305

  Fly   269 HSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVY 333
            |:|||.:|||:||..:.|...::|..:|.|...|:.:..|..|..|.|: .|...::||.:|:.|
 Frog   306 HAYGQMLMYPYGYKSEKPPNSKKLDKIAVSALKALSTLYGTSYTHGPIA-TTIYPVSGSSIDWAY 369

  Fly   334 GV-LKVPMALVMELPSRELGFQPPVEMISQIGHESWYGIREMCK 376
            .. :|...|..:. ...:.||..|...|.:...|:...::.:.|
 Frog   370 DEGMKYSFAFELR-DEGQYGFLLPENQIKKTCMETMLAVKAIAK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 86/329 (26%)
LOC105947369XP_012818774.2 Propep_M14 33..104 CDD:366995 2/11 (18%)
Peptidase_M14_like 116..415 CDD:386095 88/340 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.