DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and LOC100489361

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_017952843.2 Gene:LOC100489361 / 100489361 -ID:- Length:454 Species:Xenopus tropicalis


Alignment Length:350 Identity:99/350 - (28%)
Similarity:168/350 - (48%) Gaps:49/350 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TDATTALRRLVIPRPDILHTYLDYKQVNQYLQYLAQ---RYAHFVHVHILGHTHEKREIRALEIN 95
            |...|.::::.:...|    |..|..:::...::.|   ::...|..|.:|.|:|.|.|...:|.
 Frog   108 TPIETKMQKISLDNYD----YTKYHPMDEIYDWMEQIQLKHRDLVTKHFMGSTYELRPIYYFKIG 168

  Fly    96 WMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCI 160
            |.:.:.                                  :|.:|::.|.||||||:|:.....:
 Frog   169 WPSDKP----------------------------------KKIIFMDCGIHAREWIAVAYCQWFV 199

  Fly   161 YQLTERYTRN---IEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYD 222
            .::...::.|   ..||:::.|.:||:.|.|||.||.|....|||||.||.:|...|.|.|||::
 Frog   200 KEILSSHSNNKLLTNVLKQVDFYVVPVFNIDGYIYSWTTERLWRKNRSPHNNATCYGVDLNRNFN 264

  Fly   223 IFWNS-GPSK-INRNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDN 285
            ..|.| |.|: .|..|:.|.:|.|||||:|:..:::|..|.:||:|::|||||.|:.|:|...:.
 Frog   265 SSWCSVGASRDCNSQTFCGSAPASEPETQAVANLMERTKSQILFYLTIHSYGQYILLPYGSTTNP 329

  Fly   286 PIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMEL-PSR 349
            .:...|::.:|.:..:.:|..:...|..||.|.:.... :||..|:. |.:.:..:...|| .:.
 Frog   330 SVNHVEMTKVAEAAAAKMKEKHNIVYTVGSSSVVLYEN-SGSSCDWA-GDIGIKFSYTFELRDNG 392

  Fly   350 ELGFQPPVEMISQIGHESWYGIREM 374
            ..|||.|.|:|.....|:...:..|
 Frog   393 TYGFQLPAELIKPTCEETMTAVISM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 95/329 (29%)
LOC100489361XP_017952843.2 Propep_M14 36..106 CDD:396700
Peptidase_M14_like 124..420 CDD:416253 95/329 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.