DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpo.2

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_002937157.1 Gene:cpo.2 / 100487462 XenbaseID:XB-GENE-22169695 Length:454 Species:Xenopus tropicalis


Alignment Length:368 Identity:100/368 - (27%)
Similarity:168/368 - (45%) Gaps:67/368 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118
            |....::..::..:.::::..|..|.:|.|:|.|.:..|:|.|.:.:.                 
 Frog   127 YHPMDEIYNWMDLMKEKHSEIVSQHYIGCTYELRPMYYLKIGWPSDKQ----------------- 174

  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRN---IEVLRKLRFI 180
                             :|..||:.|.||||||||:.....:.::...|..:   ..||:::.|.
 Frog   175 -----------------KKIFFIDCGFHAREWISVAFCQWFVNEIVSHYKTDAILANVLKQVDFY 222

  Fly   181 IVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNS-GPSK-INRNTYKGESPF 243
            ::|::|.|||.|:.|.|..|||||.||::....|.|.|||:|..|.| |.|: .|.||:.|....
 Frog   223 VLPVMNIDGYVYTWTTNRLWRKNRSPHENGTCYGVDLNRNFDSQWCSIGASRDCNSNTFCGPEAA 287

  Fly   244 SEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNG 308
            |||||:|:..::::..|::|.:|::|||||.|:.|:||.:|......|:..:|.:..:.:|..:.
 Frog   288 SEPETKALSGLIEKTKSDILCYLTIHSYGQMILLPYGYKKDPSPNHDEMMLVAKNAVAKMKEKHN 352

  Fly   309 REYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMEL-PSRELGFQPPVEMISQIGHESWYGIR 372
            .||...| |.:.....:||..|:.. .|.:.::..:|| .:...||..|.:.|.....|:...:.
 Frog   353 NEYEYES-SAVILYYDSGSSGDWTV-ELGIQLSYTLELRDNGTYGFVLPPDQIKPTCEETTTAVM 415

  Fly   373 EMCKRSFDLRHQIVREKEPPLPWPSRHESSNEGVAIENTSTTT 415
            .|.                        |..||.. :||:..||
 Frog   416 SMV------------------------EYINEEY-LENSGVTT 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 93/328 (28%)
cpo.2XP_002937157.1 Propep_M14 36..105 CDD:366995
M14_CPO 124..421 CDD:349466 94/353 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.