DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpo.1

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_031748368.1 Gene:cpo.1 / 100145253 XenbaseID:XB-GENE-989447 Length:451 Species:Xenopus tropicalis


Alignment Length:327 Identity:100/327 - (30%)
Similarity:158/327 - (48%) Gaps:46/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TYLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFD 117
            ||....::.|::..:.:.|:..|.:|.||.|:|.|.|...:|.|.:.:.                
 Frog   126 TYHPMDEIYQWMDQVKEAYSDLVSMHYLGSTYELRPIYYFKIGWPSDKQ---------------- 174

  Fly   118 IGPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRN---IEVLRKLRF 179
                              :|.::::.|.||||||:|:.....:.::.|.:..|   .:||..:.|
 Frog   175 ------------------KKIIWMDCGIHAREWIAVAYCQWFVKEILETHKTNPLLQKVLHNIDF 221

  Fly   180 IIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNS-GPSKINRN-TYKGESP 242
            .|||::|.||:.||...|..|||:|.||.:....|.|.|||::..|.| |.|...|: ||.|..|
 Frog   222 YIVPVLNIDGFVYSWNVNRLWRKSRSPHNNGSCYGVDLNRNFNSKWGSIGASNNCRDETYCGTGP 286

  Fly   243 FSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYN 307
            .||||..|:..:|..:.|::|.||::|||||.::.|:||.:|..|...|:.::|....:.::..:
 Frog   287 ASEPEVNAVSKLLGSLKSDVLCFLTIHSYGQLLLLPYGYTKDPSINHEEMINVAQKAAAKLQEKH 351

  Fly   308 GREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSREL---GFQPPVEMISQIGHESWY 369
            |.|||.||.|.|.... :||..|:... |.:..:...||  |:.   ||..|...|.....|:..
 Frog   352 GTEYRVGSTSHLLYSN-SGSSRDWATD-LGINFSYTFEL--RDTGAHGFILPANQIRPTCEETMA 412

  Fly   370 GI 371
            |:
 Frog   413 GV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 99/326 (30%)
cpo.1XP_031748368.1 Propep_M14 36..105 CDD:396700
M14_CPO 124..421 CDD:349466 100/327 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.