DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpa6

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001120005.1 Gene:cpa6 / 100144967 XenbaseID:XB-GENE-960985 Length:433 Species:Xenopus tropicalis


Alignment Length:371 Identity:99/371 - (26%)
Similarity:155/371 - (41%) Gaps:88/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LALLVVERLHLNIKCQTAKDRSRTDATTALRRLVIPRPDILHTYLDYKQVNQYLQYLAQRYAHFV 75
            |:.|:.|::...|.....:        |.|....:.||......|.....|:|            
 Frog    90 LSYLIKEKVQHRILVNNVQ--------TMLEAQQVSRPRRKRRSLSKYNYNEY------------ 134

  Fly    76 HVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPN--GRFTVPVIHVGEHC--- 135
                    |...||.    :||...| :..|.:    ..||.||.:  || ::.|:.:|:..   
 Frog   135 --------HPLHEIE----SWMFYMN-KTHPDL----VSLFSIGKSYEGR-SLFVLKLGKRTNSY 181

  Fly   136 RKTVFIEAGTHAREWIS-------VSTALNCIYQLTERYTRNIE-----VLRKLRFIIVPLVNPD 188
            :|.|:|:.|.||||||.       |..|:|         |.|.:     :|..|...::|:.|.|
 Frog   182 KKAVWIDCGMHAREWIGPAFCQWFVKEAIN---------TYNTDPAMKKILNLLYIYVMPVFNVD 237

  Fly   189 GYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN--RNTYKGESPFSEPETRAM 251
            ||.:|...:..|||.|..:...:..|.|.|||:.:.|:...:.:|  .|||.|..|.||||.:|:
 Frog   238 GYHFSWNTDRFWRKTRSKNTRYQCYGVDANRNWKVHWSDEGASLNPCDNTYCGPFPESEPEVKAV 302

  Fly   252 RCILDRMSSNLLFFLSLHSYGQSIMYPWGY---------CRDNPIYWRELSSLANSGKSAIKSYN 307
            ...|.:...::..::|.|:|.|.::||:.|         |         :.|.|::...||:|..
 Frog   303 AQFLYKQRKHVRAYMSFHAYAQMLLYPYSYQYGAIPNFGC---------VESAAHNAVLAIRSAY 358

  Fly   308 GREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSRELGF 353
            |..||.|..|. |....:||.:|:.|. ..:|.:...||  |:.|:
 Frog   359 GIRYRHGPASS-TLYLTSGSSMDWAYN-NGIPYSYAFEL--RDTGY 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 91/328 (28%)
cpa6NP_001120005.1 Propep_M14 39..113 CDD:280416 6/30 (20%)
Peptidase_M14_like 133..432 CDD:299699 89/320 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.