DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpa6

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_021325980.1 Gene:cpa6 / 100002342 ZFINID:ZDB-GENE-091204-331 Length:442 Species:Danio rerio


Alignment Length:354 Identity:95/354 - (26%)
Similarity:155/354 - (43%) Gaps:69/354 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVVERLHLNIKCQTAKDRSRTDATTALRRLVIPRPDILHTYLDY---KQVNQYLQYLAQRYAHFV 75
            :::..|...|:.||....||       :|    |.::.:.|..|   :::..::..:.:.::|.|
Zfish   110 VLISNLQTEIEKQTGYRSSR-------KR----RSELQYDYEVYHPLEEIQSWMFEMNRTHSHLV 163

  Fly    76 HVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCRKTVF 140
            .:..:|.::|.|.:..|:                        :|...||          .:|.|:
Zfish   164 DLFSIGQSYEGRPLYVLQ------------------------LGKRTRF----------FKKAVW 194

  Fly   141 IEAGTHAREWIS-------VSTALNCIYQLTERYTRNIEVLRKLRFIIVPLVNPDGYEYSRTKNP 198
            |:.|.||||||.       |..|||. ||......|   ::.:|.|.|:|:.|.|||.||...:.
Zfish   195 IDCGVHAREWIGPAFCQWFVKEALNS-YQHDSSMRR---LMNQLNFYIMPVFNVDGYHYSWKMDR 255

  Fly   199 KWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN--RNTYKGESPFSEPETRAMRCILDRMSSN 261
            .|||.|.........|.|.|||:.:.|....:.::  .:||.|..|.||||.:|:...|.:....
Zfish   256 FWRKTRSKIPKYHCRGVDANRNWKVKWCDEGASLHPCDDTYCGPFPESEPEVKAVAKFLRKHKKR 320

  Fly   262 LLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTIAG 326
            :..::|:|:|.|.::||:.|.......:..:.|.|.:..||:.|..|..||.|..|. |....:|
Zfish   321 VKAYISMHAYAQMLLYPYSYKYATIPNFNCVESAAQNAVSALYSAYGVRYRYGPASS-TLYVSSG 384

  Fly   327 SVVDYVY--GVLKVPMALVMELPSRELGF 353
            |.:|:.|  |   :|.|...||  |:.|:
Zfish   385 SSMDWAYKNG---IPYAFAFEL--RDTGY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 87/314 (28%)
cpa6XP_021325980.1 Propep_M14 46..122 CDD:308061 2/11 (18%)
Peptidase_M14_like 141..440 CDD:325013 86/312 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.