DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8564 and cpb2

DIOPT Version :9

Sequence 1:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001018539.2 Gene:cpb2 / 100000935 ZFINID:ZDB-GENE-050522-259 Length:424 Species:Danio rerio


Alignment Length:376 Identity:101/376 - (26%)
Similarity:161/376 - (42%) Gaps:63/376 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LHLNIK---CQTAKDRSRTDA---------TTALRRLVI------PRPD--ILHTYLDYKQVNQY 63
            :||.|:   .|..|:..|..|         |.||..:.|      ||..  ....|...:.:..:
Zfish    69 VHLYIQSTSVQFVKEHLREHAITFRVLVENTAALVAMQIRNDTSDPRSGGVFYERYHSLEDIYYW 133

  Fly    64 LQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPV 128
            :...::.::..|.|.::|.:.|||.:..|:::....|.|                          
Zfish   134 INKTSREHSDMVKVILIGSSSEKRPLYVLKLSGKREEEV-------------------------- 172

  Fly   129 IHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEV---LRKLRFIIVPLVNPDGY 190
                   .:.::::.|.||||||:.:..:..:......|.:|.|:   |.|:...|:.::|||||
Zfish   173 -------NRAMWMDCGIHAREWIAPAFCMWFVNYALAFYNQNTEITEMLNKMDIYILTVMNPDGY 230

  Fly   191 EYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFW-NSGPSKINRN-TYKGESPFSEPETRAMRC 253
            :|:.|.:..|||||..:|.:...|.|.|||:|..| ..|.|....: ||.|:.|.|||||:|:..
Zfish   231 KYTWTTDRMWRKNRSENKDSYCAGVDLNRNFDANWCTKGASDDPCDPTYCGQFPESEPETQAVAK 295

  Fly   254 ILDRMSSNLLFFLSLHSYGQSIMYPWGYCRDNPI-YWRELSSLANSGKSAIKSYNGREYRTGSIS 317
            .|......:..:||:|||.|.:::|:. |..|.| ...||..|.....:.|:.|....|:.|| .
Zfish   296 FLRSHKDTVKLYLSIHSYSQMLLFPYS-CSYNEIPNHNELFELVKEASTKIRRYYRNNYKYGS-G 358

  Fly   318 CLTKRTIAGSVVDYVYGVLKVPMALVMELPSR-ELGFQPPVEMISQIGHES 367
            ..|.....|...|:.|. |.:..:...||..| :.||..|...|.|..:|:
Zfish   359 AKTIYLAPGGSDDWAYD-LGIKYSFTFELQDRGQYGFLLPPSFIPQACNEA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 88/321 (27%)
cpb2NP_001018539.2 Propep_M14 32..98 CDD:280416 7/28 (25%)
M14_CPB2 120..420 CDD:199868 88/325 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.