DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and SEC18

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_009636.3 Gene:SEC18 / 852372 SGDID:S000000284 Length:758 Species:Saccharomyces cerevisiae


Alignment Length:425 Identity:128/425 - (30%)
Similarity:213/425 - (50%) Gaps:77/425 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   568 KKSAEKPTDAAMDVDNVAPEEPKKAVEQEVDSSSSNDEY---YEPTLAELTNFLDNPPEEFADPN 629
            |.|.::....::|:| ::.....|||....|......::   ||..:...|.:|   ..||....
Yeast   106 KYSGKQSYLGSIDID-ISFRARGKAVSTVFDQDELAKQFVRCYESQIFSPTQYL---IMEFQGHF 166

  Fly   630 FCLTLIDFVDAIKV--MQPSAK----------------------REGFITV-------------- 656
            |.|.:.: |.||.:  ::|::.                      |:|.:.:              
Yeast   167 FDLKIRN-VQAIDLGDIEPTSAVATGIETKGILTKQTQINFFKGRDGLVNLKSSNSLRPRSNAVI 230

  Fly   657 -PDTTWDD--IGALEK-IREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAI- 716
             ||..::|  :|.|:| ..:..:.|..:.:..|.::|:||::...|:||.||||.||||:|:.| 
Yeast   231 RPDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPSVIEKLGISHVKGLLLYGPPGTGKTLIARKIG 295

  Fly   717 ----ANEAGINFISVKGPELMNMYVGESERAVRACFQ--------RARNSAPCVIFFDEFDSLCP 769
                |.|..|    |.|||:::.|||.||..:|..|:        :...|:..:|.|||.||:..
Yeast   296 TMLNAKEPKI----VNGPEILSKYVGSSEENIRNLFKDAEAEYRAKGEESSLHIIIFDELDSVFK 356

  Fly   770 KRSDGGDGNNSGTRIVNQLLTEMDGVEERKGVYILAATNRPDIIDPAILRPGRLDTILYVGFPEQ 834
            :|...|||...|..:|||||.:||||::...:.::..|||.|:||.|:|||||.:..:.:..|::
Yeast   357 QRGSRGDGTGVGDNVVNQLLAKMDGVDQLNNILVIGMTNRKDLIDSALLRPGRFEVQVEIHLPDE 421

  Fly   835 SERTEILKATTKN-GKRPVLADDVDLDEIAAQTEGYTGADLAGLVKQASMFSLRQSLN--NGDTN 896
            ..|.:|....||. .:..:::|||:|.|:||.|:.::||::.||||.||.|::.:::|  .|.|.
Yeast   422 KGRLQIFDIQTKKMRENNMMSDDVNLAELAALTKNFSGAEIEGLVKSASSFAINKTVNIGKGATK 486

  Fly   897 LD-----DLCVRSQHFQEALQQLRPS--VNEQDRK 924
            |:     .|.|..:.|..||..:.|:  ::|:|.|
Yeast   487 LNTKDIAKLKVTREDFLNALNDVTPAFGISEEDLK 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 125/418 (30%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 16/36 (44%)
AAA 699..830 CDD:278434 59/143 (41%)
SEC18NP_009636.3 CDC48_N 29..98 CDD:215012
CDC48_2 134..204 CDD:215011 13/73 (18%)
RecA-like_NSF-SEC18_r1-like 240..416 CDD:410912 68/179 (38%)
SpoVK 263..758 CDD:223540 99/263 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.