DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and ATAD1

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_001308896.1 Gene:ATAD1 / 84896 HGNCID:25903 Length:361 Species:Homo sapiens


Alignment Length:267 Identity:94/267 - (35%)
Similarity:146/267 - (54%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   660 TWDDIGALEKIREELKLAVLAPVKYPEMLE--RLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGI 722
            ||.||..|:.:..:||..|:.|:|...:.|  || |..|.||||.|||||||||:|||.|.|||.
Human    89 TWSDIAGLDDVITDLKDTVILPIKKKHLFENSRL-LQPPKGVLLYGPPGCGKTLIAKATAKEAGC 152

  Fly   723 NFISVKGPELMNMYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGDGNNSGTRIVN- 786
            .||:::...|.:.:.|||::...|.|..|....|.:||.||.||....||   ..::..|.::. 
Human   153 RFINLQPSTLTDKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRS---SSDHEATAMMKA 214

  Fly   787 QLLTEMDGVEERKG--VYILAATNRPDIIDPAILRPGRLDTILYVGFPEQSERTEILKATTKNGK 849
            |.::..||::....  |.::.|||||..:|.||:|  |:.|..::..|...:|..|||...||..
Human   215 QFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMR--RMPTRFHINQPALKQREAILKLILKNEN 277

  Fly   850 RPVLADDVDLDEIAAQTEGYTGADLAGLVKQASMFSLRQSLNNGDTNLDD----LCVRSQHFQEA 910
               :...|||.|:|.:|:|::|:||..:.:.|::..:|:.:|:......|    ..|:.|....|
Human   278 ---VDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRA 339

  Fly   911 LQQLRPS 917
            :::::.|
Human   340 IEKMKKS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 94/267 (35%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 22/38 (58%)
AAA 699..830 CDD:278434 53/133 (40%)
ATAD1NP_001308896.1 RecA-like_ATAD1 92..257 CDD:410928 67/170 (39%)
AAA_lid_3 282..321 CDD:407720 13/38 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.