DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and AT1G45000

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_175120.1 Gene:AT1G45000 / 841065 AraportID:AT1G45000 Length:399 Species:Arabidopsis thaliana


Alignment Length:323 Identity:108/323 - (33%)
Similarity:172/323 - (53%) Gaps:53/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 VVGNRAKNLSED------------------AVPRSKDHRNVPGLYQQLHQNQSRDRLRKFKRDLE 242
            |||.|:|...|.                  |:||..|    |.:|..||::..            
plant    86 VVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVD----PVVYNMLHEDPG------------ 134

  Fly   243 VQHPTESFRDIGGMDSTLKELCEML-IHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAISG 306
                ..|:..:||:...::||.|.: :.:.:||.:.::|:.|.:|:||:||||.|||.|||||:.
plant   135 ----NISYSAVGGLGDQIRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIAS 195

  Fly   307 QLKMPLMEIPATELIGGISGESEERIREVFDQAIGYSPCVLFIDEIDAIGGNR--QWASKDME-R 368
            .:....:::.::.:|....|||...|||:|:.|..:.||::|:||||||||.|  :..|.|.| :
plant   196 NIDANFLKVVSSAIIDKYIGESARLIREMFNYAREHQPCIIFMDEIDAIGGRRFSEGTSADREIQ 260

  Fly   369 RIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREILRIQ 433
            |.:.:|::.||..  ::.|: |.:|.||.|||||||.|.|.||.|.:|.|.:|:.:.|.|||:|.
plant   261 RTLMELLNQLDGF--DQLGK-VKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIH 322

  Fly   434 CEGLSVDPKLNYDKIAELTPGYVGADLMALVSRAASVAVKRRS--------MKKFRELHAASE 488
            ..|::...:::|:.|.:|..|:.||||..:.:.|...|::...        ||..|:|..|.:
plant   323 ASGIAKHGEIDYEAIVKLGEGFNGADLRNICTEAGMFAIRAERDYVIHEDFMKAVRKLSEAKK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 88/229 (38%)
AAA 287..418 CDD:278434 60/133 (45%)
P-loop_NTPase 679..>716 CDD:304359
AAA 699..830 CDD:278434
AT1G45000NP_175120.1 RPT1 17..390 CDD:224143 108/323 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.