DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and AT3G28510

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_189492.1 Gene:AT3G28510 / 822481 AraportID:AT3G28510 Length:530 Species:Arabidopsis thaliana


Alignment Length:391 Identity:90/391 - (23%)
Similarity:160/391 - (40%) Gaps:88/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 NLSEDAVP-RSKDHRNVPGLYQQLHQNQSRDRLRKFKRDLEVQHPTESFRDIGGMDSTLKE--LC 264
            |.|::..| ||....|||                       ..||. :|..: .||...||  ..
plant   184 NSSQEWYPWRSGKWSNVP-----------------------FHHPA-TFETL-AMDPEKKEGIKK 223

  Fly   265 EMLIHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAISGQLKMPLMEIPATELIGGISGESE 329
            :::...|..::|.::|....||.||.||||.||:.:..||:..|...:.::..|.:     .::.
plant   224 DLIKFSKGKDYYKKVGKPWKRGYLLFGPPGTGKSTMIAAIANFLDYDVYDLELTTV-----KDNS 283

  Fly   330 ERIREVFDQAIGYSPCVLFIDEIDA---IGGNRQWASKDMERR---------------------I 370
            |..:.:.|..   |..::.|::||.   :.|.|:...::.|..                     .
plant   284 ELKKLLLDTT---SKSIIVIEDIDCSLDLTGQRKKKKEEDEEEDGEEKKEGEKKPKVDDKQSKVT 345

  Fly   371 VSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREILRIQCE 435
            :|.|::|:|.|.:...|:.::|. .|...|.|||.|.|.||.|:    ||.....:.|..::..:
plant   346 LSGLLNSIDGLWSACSGEKIIVF-TTNFVDKLDPALIRRGRMDN----HIEMSYCKFEAFKVLAK 405

  Fly   436 G-LSVDPKLNYDKI------AELTPGYVGADLMALVSRA-ASVAVKRRSMKKFRELHAASEKNMT 492
            . |.::....|.:|      .:::|..|...||...... |.:.:| |.:|...|....:.|   
plant   406 NYLEIETHDLYGEIERKLEETDMSPADVAETLMPKSDEEDADICIK-RLVKTLEEEKEKARK--- 466

  Fly   493 TVTLDDDEPSEDAGETPVPDSKGEETAKDAEAEQKVDGDKETSAKDKSEGDSPNIETPKKATNGN 557
               |.::|..:.|.:    ::|..:.|::||.::|...:.|...|.|::.::.|:    ...|||
plant   467 ---LAEEEEKKKAEK----EAKKMKKAEEAEEKKKKTEEDEKKEKVKAKEENGNV----SQQNGN 520

  Fly   558 S 558
            |
plant   521 S 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 75/320 (23%)
AAA 287..418 CDD:278434 38/154 (25%)
P-loop_NTPase 679..>716 CDD:304359
AAA 699..830 CDD:278434
AT3G28510NP_189492.1 AAA_assoc 29..124 CDD:291061
AAA 243..392 CDD:214640 42/161 (26%)
AAA 246..394 CDD:278434 40/160 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.