DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and NSF

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_006169.2 Gene:NSF / 4905 HGNCID:8016 Length:744 Species:Homo sapiens


Alignment Length:322 Identity:110/322 - (34%)
Similarity:174/322 - (54%) Gaps:34/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   650 REGFITVPDTTWD--DIGALEK-IREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTL 711
            |:..|. ||..::  .||.|:| ..:..:.|..:.|..||::|::|.....|:||.|||||||||
Human   205 RQSIIN-PDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTL 268

  Fly   712 LAKAI-----ANEAGINFISVKGPELMNMYVGESERAVRACFQRAR--------NSAPCVIFFDE 763
            ||:.|     |.|..:    |.|||::|.||||||..:|..|..|.        ||...:|.|||
Human   269 LARQIGKMLNAREPKV----VNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDE 329

  Fly   764 FDSLCPKRSDGGDGNNSGTRIVNQLLTEMDGVEERKGVYILAATNRPDIIDPAILRPGRLDTILY 828
            .|::|.:|............:|||||:::||||:...:.::..|||||:||.|:||||||:..:.
Human   330 IDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKME 394

  Fly   829 VGFPEQSERTEILKA-TTKNGKRPVLADDVDLDEIAAQTEGYTGADLAGLVKQASMFSLRQSLNN 892
            :|.|::..|.:||.. |.:.....:|:.|||:.|:|.:|:.::||:|.|||:.|...::.:.: .
Human   395 IGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHI-K 458

  Fly   893 GDTNL-------DDLCVRSQHFQEALQ-QLRPS--VNEQDRKIYDKLR-LKYAAPRVPTLND 943
            ..|.:       :.|.|....|..:|: .::|:  .|::|...|.... :|:..|....|:|
Human   459 ASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDD 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 103/295 (35%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 19/36 (53%)
AAA 699..830 CDD:278434 62/143 (43%)
NSFNP_006169.2 CDC48_N 6..83 CDD:215012
CDC48_2 111..>159 CDD:308534
SpoVK <142..490 CDD:223540 102/290 (35%)
AAA 538..670 CDD:214640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.